Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0CNU8

Protein Details
Accession B0CNU8    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
29-56IKEGRKECTRSRTKRRPRQNNKHGVCPLBasic
NLS Segment(s)
PositionSequence
41-45TKRRP
Subcellular Location(s) nucl 16, mito_nucl 13.499, cyto_nucl 10.333, mito 9.5
Family & Domain DBs
KEGG lbc:LACBIDRAFT_301570  -  
Amino Acid Sequences MTGSRGKTHQKSITNSATQIKTCKEATNIKEGRKECTRSRTKRRPRQNNKHGVCPLDKNHIRPRHRLWIGQGTWQSSKCASANVDEDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.57
3 0.55
4 0.5
5 0.44
6 0.42
7 0.36
8 0.32
9 0.31
10 0.3
11 0.29
12 0.34
13 0.34
14 0.41
15 0.44
16 0.43
17 0.49
18 0.47
19 0.47
20 0.46
21 0.49
22 0.43
23 0.49
24 0.56
25 0.58
26 0.69
27 0.74
28 0.78
29 0.83
30 0.89
31 0.9
32 0.91
33 0.93
34 0.93
35 0.93
36 0.84
37 0.83
38 0.75
39 0.67
40 0.58
41 0.52
42 0.44
43 0.44
44 0.43
45 0.4
46 0.47
47 0.53
48 0.54
49 0.56
50 0.61
51 0.61
52 0.62
53 0.6
54 0.56
55 0.57
56 0.55
57 0.55
58 0.5
59 0.44
60 0.45
61 0.42
62 0.38
63 0.28
64 0.31
65 0.24
66 0.25
67 0.22
68 0.23