Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2RBR3

Protein Details
Accession M2RBR3    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
6-42AGWPGRFRRARQLRVRREPGRRPRRVRLRRAGQLRQPBasic
46-72LWKPEPGPGRVRRRRRGRGHAREGRGVBasic
NLS Segment(s)
PositionSequence
4-85RRAGWPGRFRRARQLRVRREPGRRPRRVRLRRAGQLRQPESELWKPEPGPGRVRRRRRGRGHAREGRGVPRAENGLGRAKPG
Subcellular Location(s) nucl 13, cyto 7, mito 6
Family & Domain DBs
Amino Acid Sequences LRLRRAGWPGRFRRARQLRVRREPGRRPRRVRLRRAGQLRQPESELWKPEPGPGRVRRRRRGRGHAREGRGVPRAENGLGRAKPGPEPGPGTELDGPGGRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.76
3 0.77
4 0.8
5 0.8
6 0.83
7 0.9
8 0.87
9 0.87
10 0.88
11 0.88
12 0.88
13 0.87
14 0.84
15 0.85
16 0.88
17 0.88
18 0.88
19 0.87
20 0.86
21 0.84
22 0.85
23 0.82
24 0.77
25 0.77
26 0.69
27 0.6
28 0.52
29 0.44
30 0.41
31 0.37
32 0.34
33 0.26
34 0.26
35 0.24
36 0.26
37 0.3
38 0.27
39 0.31
40 0.36
41 0.45
42 0.52
43 0.62
44 0.68
45 0.73
46 0.81
47 0.83
48 0.85
49 0.86
50 0.87
51 0.89
52 0.88
53 0.81
54 0.77
55 0.7
56 0.64
57 0.58
58 0.47
59 0.37
60 0.31
61 0.29
62 0.24
63 0.23
64 0.21
65 0.24
66 0.23
67 0.25
68 0.24
69 0.24
70 0.25
71 0.29
72 0.29
73 0.24
74 0.29
75 0.28
76 0.29
77 0.28
78 0.31
79 0.28
80 0.26
81 0.24