Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2QIT7

Protein Details
Accession M2QIT7   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
10-32DDVESGRKRKRLPKGLRDYEGNIBasic
NLS Segment(s)
PositionSequence
16-23RKRKRLPK
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MSRKRVLEADDVESGRKRKRLPKGLRDYEGNIVLWGQHGILDRNPETFELHDMVIDPHSPGFERADFNSTVISATTSSSSEVHSIEYIPTLPPIGQHVSGPSNASINSPNLNSSMNLTQLRGRMQVVYESNGSHINSLQRSSITPVPTPQTPSGPPPVPYCSRPDMPATSLYETRMSTPSAIERGSCDHHPSGVQLNDAVDATGIHDTPLISMSSPITQHFSILNDEADVDFNMSKENWTRIVAQYDELNARPPAKAVVNSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.39
3 0.41
4 0.43
5 0.47
6 0.57
7 0.65
8 0.71
9 0.78
10 0.83
11 0.87
12 0.85
13 0.8
14 0.73
15 0.67
16 0.59
17 0.48
18 0.37
19 0.28
20 0.23
21 0.18
22 0.15
23 0.09
24 0.09
25 0.1
26 0.12
27 0.14
28 0.2
29 0.2
30 0.21
31 0.22
32 0.2
33 0.2
34 0.19
35 0.2
36 0.16
37 0.15
38 0.14
39 0.14
40 0.14
41 0.13
42 0.12
43 0.1
44 0.08
45 0.09
46 0.1
47 0.1
48 0.12
49 0.13
50 0.15
51 0.16
52 0.2
53 0.2
54 0.2
55 0.19
56 0.16
57 0.14
58 0.11
59 0.1
60 0.07
61 0.07
62 0.08
63 0.08
64 0.09
65 0.09
66 0.1
67 0.11
68 0.11
69 0.11
70 0.1
71 0.1
72 0.09
73 0.09
74 0.09
75 0.08
76 0.08
77 0.07
78 0.07
79 0.07
80 0.1
81 0.11
82 0.11
83 0.11
84 0.13
85 0.14
86 0.15
87 0.15
88 0.12
89 0.11
90 0.11
91 0.12
92 0.11
93 0.11
94 0.12
95 0.11
96 0.11
97 0.11
98 0.12
99 0.11
100 0.12
101 0.12
102 0.14
103 0.14
104 0.14
105 0.15
106 0.16
107 0.17
108 0.16
109 0.15
110 0.12
111 0.12
112 0.15
113 0.14
114 0.14
115 0.13
116 0.12
117 0.13
118 0.14
119 0.14
120 0.1
121 0.11
122 0.11
123 0.12
124 0.12
125 0.12
126 0.1
127 0.11
128 0.14
129 0.17
130 0.16
131 0.16
132 0.17
133 0.19
134 0.2
135 0.23
136 0.21
137 0.2
138 0.19
139 0.22
140 0.26
141 0.25
142 0.25
143 0.24
144 0.28
145 0.28
146 0.28
147 0.3
148 0.29
149 0.29
150 0.29
151 0.29
152 0.27
153 0.25
154 0.28
155 0.26
156 0.24
157 0.24
158 0.23
159 0.22
160 0.2
161 0.21
162 0.18
163 0.16
164 0.14
165 0.14
166 0.15
167 0.15
168 0.15
169 0.13
170 0.13
171 0.16
172 0.19
173 0.19
174 0.21
175 0.19
176 0.2
177 0.2
178 0.21
179 0.24
180 0.21
181 0.2
182 0.17
183 0.16
184 0.16
185 0.16
186 0.14
187 0.07
188 0.06
189 0.07
190 0.07
191 0.07
192 0.06
193 0.07
194 0.07
195 0.07
196 0.09
197 0.08
198 0.07
199 0.08
200 0.09
201 0.11
202 0.12
203 0.13
204 0.16
205 0.15
206 0.16
207 0.17
208 0.17
209 0.18
210 0.19
211 0.18
212 0.14
213 0.15
214 0.14
215 0.14
216 0.12
217 0.11
218 0.1
219 0.09
220 0.11
221 0.11
222 0.13
223 0.16
224 0.19
225 0.19
226 0.21
227 0.25
228 0.27
229 0.33
230 0.31
231 0.29
232 0.28
233 0.29
234 0.31
235 0.28
236 0.28
237 0.25
238 0.25
239 0.24
240 0.22
241 0.23
242 0.24