Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0DR80

Protein Details
Accession B0DR80    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
20-41MAKAATKKGKKKVSPKAKGASKHydrophilic
NLS Segment(s)
PositionSequence
4-39KRAKASGKGTAMKPSTMAKAATKKGKKKVSPKAKGA
Subcellular Location(s) nucl 19.5, cyto_nucl 11, mito 6
Family & Domain DBs
KEGG lbc:LACBIDRAFT_307924  -  
Amino Acid Sequences MREKRAKASGKGTAMKPSTMAKAATKKGKKKVSPKAKGASKLVEIDSGDESDGMTALKGVEERELKQGARRGPENESMKRFHDPVAVRDSRGNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.46
3 0.41
4 0.35
5 0.31
6 0.27
7 0.27
8 0.24
9 0.3
10 0.36
11 0.44
12 0.49
13 0.54
14 0.61
15 0.69
16 0.71
17 0.74
18 0.79
19 0.8
20 0.81
21 0.8
22 0.8
23 0.77
24 0.74
25 0.66
26 0.58
27 0.49
28 0.42
29 0.35
30 0.27
31 0.21
32 0.17
33 0.15
34 0.12
35 0.1
36 0.08
37 0.07
38 0.05
39 0.05
40 0.04
41 0.03
42 0.03
43 0.03
44 0.03
45 0.04
46 0.05
47 0.09
48 0.11
49 0.12
50 0.17
51 0.19
52 0.19
53 0.24
54 0.28
55 0.28
56 0.32
57 0.34
58 0.33
59 0.35
60 0.44
61 0.47
62 0.48
63 0.49
64 0.46
65 0.46
66 0.48
67 0.44
68 0.37
69 0.37
70 0.33
71 0.34
72 0.41
73 0.4
74 0.37