Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2R359

Protein Details
Accession M2R359   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
71-98CSIPEHRQQLRRRIRRCRGARMRPGDCGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 11.5, mito 6
Family & Domain DBs
Amino Acid Sequences MARHSESYSRRYSGRPTEYPTSWRTCSESRYSIVYECIVKCSRSAGPRFSHRTHVQHERVLVLREGARTRCSIPEHRQQLRRRIRRCRGARMRPGDCGSRGRTDHSSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.51
3 0.52
4 0.56
5 0.56
6 0.58
7 0.54
8 0.5
9 0.44
10 0.41
11 0.39
12 0.35
13 0.37
14 0.39
15 0.37
16 0.33
17 0.34
18 0.33
19 0.29
20 0.27
21 0.24
22 0.22
23 0.18
24 0.21
25 0.2
26 0.18
27 0.17
28 0.19
29 0.21
30 0.24
31 0.27
32 0.27
33 0.3
34 0.38
35 0.45
36 0.43
37 0.47
38 0.46
39 0.47
40 0.47
41 0.52
42 0.47
43 0.42
44 0.41
45 0.35
46 0.32
47 0.29
48 0.24
49 0.16
50 0.14
51 0.15
52 0.17
53 0.16
54 0.16
55 0.16
56 0.18
57 0.2
58 0.24
59 0.29
60 0.33
61 0.42
62 0.5
63 0.56
64 0.63
65 0.66
66 0.72
67 0.75
68 0.79
69 0.78
70 0.8
71 0.82
72 0.84
73 0.85
74 0.86
75 0.86
76 0.87
77 0.88
78 0.87
79 0.8
80 0.77
81 0.73
82 0.67
83 0.59
84 0.55
85 0.49
86 0.47
87 0.45
88 0.44