Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2QEQ0

Protein Details
Accession M2QEQ0   
Localization Confidence High
Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
4-23TIARAPHAMHPNKRQRRTATHydrophilic
57-88IEEARRGKVREKKEREKKEKRAKAPVKPHDKGBasic
191-218ITSGTPPPPKSRKKRPAVRKGWKGWVEGHydrophilic
NLS Segment(s)
PositionSequence
61-87RRGKVREKKEREKKEKRAKAPVKPHDK
197-213PPPKSRKKRPAVRKGWK
Subcellular Location(s) mito 21.5, cyto_mito 11.5, nucl 4
Family & Domain DBs
Amino Acid Sequences MAITIARAPHAMHPNKRQRRTATSVLAGDFDTRPQRDVLTSLLNGVPAPASKEMESIEEARRGKVREKKEREKKEKRAKAPVKPHDKGLEPVASTSSAPGVPIAHKHASKRGRDSRHESLPRPSPSSFWLARPSIIIPTMQRQESVTPPPMASSPPTTPGPSISSTTSATSSKRPRTPYDDEDFESHNASITSGTPPPPKSRKKRPAVRKGWKGWVEGSPSPSEKLINLDVVTILPERKTRSGKAFDAIGVGKDSWV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.73
3 0.8
4 0.8
5 0.78
6 0.79
7 0.79
8 0.77
9 0.73
10 0.68
11 0.63
12 0.55
13 0.49
14 0.4
15 0.35
16 0.26
17 0.23
18 0.24
19 0.22
20 0.23
21 0.22
22 0.23
23 0.22
24 0.23
25 0.22
26 0.21
27 0.2
28 0.21
29 0.2
30 0.19
31 0.18
32 0.16
33 0.13
34 0.09
35 0.12
36 0.11
37 0.13
38 0.13
39 0.14
40 0.15
41 0.16
42 0.18
43 0.18
44 0.19
45 0.23
46 0.24
47 0.25
48 0.28
49 0.28
50 0.34
51 0.39
52 0.47
53 0.52
54 0.61
55 0.7
56 0.77
57 0.86
58 0.89
59 0.92
60 0.93
61 0.93
62 0.92
63 0.89
64 0.9
65 0.87
66 0.85
67 0.85
68 0.84
69 0.83
70 0.75
71 0.71
72 0.64
73 0.58
74 0.5
75 0.43
76 0.37
77 0.26
78 0.25
79 0.22
80 0.18
81 0.16
82 0.14
83 0.11
84 0.07
85 0.07
86 0.07
87 0.07
88 0.07
89 0.09
90 0.14
91 0.16
92 0.18
93 0.19
94 0.27
95 0.33
96 0.36
97 0.44
98 0.48
99 0.51
100 0.56
101 0.63
102 0.62
103 0.65
104 0.66
105 0.58
106 0.56
107 0.57
108 0.53
109 0.48
110 0.42
111 0.33
112 0.3
113 0.34
114 0.29
115 0.22
116 0.25
117 0.21
118 0.21
119 0.21
120 0.2
121 0.15
122 0.14
123 0.13
124 0.09
125 0.14
126 0.16
127 0.15
128 0.15
129 0.15
130 0.16
131 0.19
132 0.22
133 0.21
134 0.19
135 0.18
136 0.19
137 0.19
138 0.17
139 0.16
140 0.16
141 0.14
142 0.17
143 0.19
144 0.19
145 0.18
146 0.19
147 0.2
148 0.18
149 0.19
150 0.16
151 0.17
152 0.17
153 0.18
154 0.18
155 0.17
156 0.17
157 0.23
158 0.3
159 0.35
160 0.4
161 0.43
162 0.46
163 0.53
164 0.59
165 0.58
166 0.57
167 0.53
168 0.5
169 0.48
170 0.45
171 0.38
172 0.32
173 0.24
174 0.18
175 0.14
176 0.13
177 0.11
178 0.1
179 0.12
180 0.12
181 0.16
182 0.2
183 0.22
184 0.31
185 0.4
186 0.49
187 0.56
188 0.66
189 0.73
190 0.79
191 0.87
192 0.89
193 0.91
194 0.92
195 0.93
196 0.92
197 0.89
198 0.88
199 0.81
200 0.73
201 0.65
202 0.59
203 0.55
204 0.48
205 0.44
206 0.39
207 0.36
208 0.35
209 0.32
210 0.28
211 0.22
212 0.23
213 0.22
214 0.2
215 0.19
216 0.18
217 0.17
218 0.16
219 0.17
220 0.14
221 0.13
222 0.12
223 0.16
224 0.2
225 0.27
226 0.33
227 0.37
228 0.44
229 0.51
230 0.52
231 0.52
232 0.5
233 0.43
234 0.42
235 0.37
236 0.3
237 0.25