Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2PPL4

Protein Details
Accession M2PPL4    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
111-139FKHSEKPKSEKKVKEKAPKDKKAEKKEEABasic
206-228EVPKEEKKEEKPKSPKVSRRLSABasic
NLS Segment(s)
PositionSequence
96-137DRPKSPGLLAKLLAPFKHSEKPKSEKKVKEKAPKDKKAEKKE
210-237EEKKEEKPKSPKVSRRLSARVGEFFKSK
Subcellular Location(s) nucl 12, cyto_nucl 11.333, cyto 9.5, mito_nucl 8.333, mito 3.5
Family & Domain DBs
Amino Acid Sequences MSDTAAAAPAPVEEVKPTEAPAVEPAPASEPAAVEAPATEAPKEEPKAEEPAPATEAPAAEAPAADAPAAEPAAEEPAIEEAKPAEPAATETKKEDRPKSPGLLAKLLAPFKHSEKPKSEKKVKEKAPKDKKAEKKEEAPAAAPATEEAPKEEPAAVAEEAPAAEPVKAEETPAEPVKETESAPAEAPAPAEETAPAEAAPVAEAEVPKEEKKEEKPKSPKVSRRLSARVGEFFKSKPKAEHNTPPKVEENPPVIEEPTPVAPLENPAAETAATEAAPVTIAEEAPKVEAPPATPVVAAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.15
3 0.16
4 0.17
5 0.18
6 0.18
7 0.18
8 0.21
9 0.21
10 0.18
11 0.18
12 0.17
13 0.18
14 0.18
15 0.18
16 0.14
17 0.13
18 0.13
19 0.15
20 0.14
21 0.1
22 0.09
23 0.11
24 0.12
25 0.13
26 0.12
27 0.11
28 0.14
29 0.21
30 0.23
31 0.23
32 0.23
33 0.25
34 0.32
35 0.32
36 0.33
37 0.28
38 0.28
39 0.3
40 0.27
41 0.25
42 0.19
43 0.19
44 0.16
45 0.15
46 0.12
47 0.09
48 0.09
49 0.09
50 0.08
51 0.08
52 0.06
53 0.05
54 0.05
55 0.07
56 0.07
57 0.06
58 0.05
59 0.05
60 0.08
61 0.08
62 0.07
63 0.06
64 0.09
65 0.1
66 0.09
67 0.09
68 0.08
69 0.09
70 0.1
71 0.1
72 0.07
73 0.07
74 0.1
75 0.18
76 0.2
77 0.2
78 0.22
79 0.28
80 0.35
81 0.42
82 0.46
83 0.44
84 0.48
85 0.52
86 0.53
87 0.53
88 0.5
89 0.47
90 0.43
91 0.37
92 0.33
93 0.32
94 0.3
95 0.24
96 0.22
97 0.2
98 0.21
99 0.28
100 0.28
101 0.3
102 0.36
103 0.44
104 0.51
105 0.59
106 0.64
107 0.66
108 0.72
109 0.77
110 0.79
111 0.82
112 0.82
113 0.83
114 0.85
115 0.85
116 0.83
117 0.83
118 0.83
119 0.83
120 0.83
121 0.76
122 0.72
123 0.69
124 0.65
125 0.56
126 0.47
127 0.38
128 0.3
129 0.25
130 0.18
131 0.12
132 0.09
133 0.09
134 0.09
135 0.09
136 0.1
137 0.1
138 0.11
139 0.11
140 0.09
141 0.09
142 0.11
143 0.09
144 0.08
145 0.07
146 0.07
147 0.06
148 0.07
149 0.06
150 0.04
151 0.04
152 0.04
153 0.05
154 0.07
155 0.07
156 0.07
157 0.07
158 0.08
159 0.12
160 0.14
161 0.14
162 0.12
163 0.12
164 0.14
165 0.15
166 0.14
167 0.13
168 0.13
169 0.14
170 0.14
171 0.14
172 0.13
173 0.12
174 0.12
175 0.09
176 0.09
177 0.08
178 0.08
179 0.08
180 0.08
181 0.08
182 0.08
183 0.08
184 0.06
185 0.06
186 0.06
187 0.06
188 0.04
189 0.04
190 0.05
191 0.05
192 0.06
193 0.09
194 0.11
195 0.12
196 0.13
197 0.14
198 0.19
199 0.28
200 0.38
201 0.42
202 0.5
203 0.59
204 0.68
205 0.77
206 0.82
207 0.82
208 0.8
209 0.83
210 0.79
211 0.78
212 0.75
213 0.7
214 0.66
215 0.62
216 0.59
217 0.52
218 0.49
219 0.42
220 0.37
221 0.4
222 0.39
223 0.37
224 0.36
225 0.41
226 0.47
227 0.52
228 0.62
229 0.62
230 0.68
231 0.67
232 0.66
233 0.61
234 0.57
235 0.53
236 0.49
237 0.45
238 0.37
239 0.37
240 0.34
241 0.32
242 0.28
243 0.25
244 0.21
245 0.18
246 0.16
247 0.14
248 0.13
249 0.13
250 0.15
251 0.17
252 0.15
253 0.14
254 0.13
255 0.14
256 0.13
257 0.13
258 0.11
259 0.1
260 0.09
261 0.08
262 0.08
263 0.07
264 0.08
265 0.07
266 0.07
267 0.06
268 0.06
269 0.08
270 0.09
271 0.09
272 0.11
273 0.12
274 0.11
275 0.13
276 0.14
277 0.15
278 0.19
279 0.21
280 0.2
281 0.19