Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2QYI1

Protein Details
Accession M2QYI1    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
26-55RSAVRRPHVPCRKGRRRTVRPSPPRAPARCBasic
NLS Segment(s)
PositionSequence
9-70PRRHALHPSPRPPAGPPRSAVRRPHVPCRKGRRRTVRPSPPRAPARCGGHRERRVHRAKQRH
Subcellular Location(s) mito 13, nucl 7, cyto 7, cyto_nucl 7
Family & Domain DBs
Amino Acid Sequences DKAFSRAQPRRHALHPSPRPPAGPPRSAVRRPHVPCRKGRRRTVRPSPPRAPARCGGHRERRVHRAKQRHLGAHALVLHHVRAAHPARALRPRVDERDYFGYLVCDCYRSRVGVDGLDATKRPGVQKLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.72
3 0.7
4 0.71
5 0.67
6 0.63
7 0.58
8 0.6
9 0.56
10 0.5
11 0.44
12 0.46
13 0.53
14 0.57
15 0.59
16 0.56
17 0.59
18 0.6
19 0.69
20 0.7
21 0.67
22 0.71
23 0.76
24 0.79
25 0.78
26 0.83
27 0.83
28 0.84
29 0.88
30 0.89
31 0.89
32 0.88
33 0.89
34 0.84
35 0.82
36 0.81
37 0.73
38 0.66
39 0.62
40 0.59
41 0.56
42 0.56
43 0.54
44 0.56
45 0.6
46 0.63
47 0.62
48 0.64
49 0.65
50 0.68
51 0.69
52 0.69
53 0.68
54 0.7
55 0.7
56 0.64
57 0.58
58 0.52
59 0.44
60 0.36
61 0.31
62 0.22
63 0.18
64 0.15
65 0.13
66 0.11
67 0.1
68 0.08
69 0.13
70 0.15
71 0.16
72 0.19
73 0.21
74 0.25
75 0.32
76 0.35
77 0.31
78 0.35
79 0.39
80 0.43
81 0.45
82 0.42
83 0.4
84 0.44
85 0.42
86 0.36
87 0.3
88 0.26
89 0.21
90 0.24
91 0.19
92 0.15
93 0.13
94 0.18
95 0.2
96 0.19
97 0.2
98 0.21
99 0.22
100 0.21
101 0.23
102 0.23
103 0.22
104 0.23
105 0.23
106 0.2
107 0.21
108 0.22
109 0.22