Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2Q4B5

Protein Details
Accession M2Q4B5   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-22RSRVTVCKRLNLKCDRRTPCHydrophilic
NLS Segment(s)
PositionSequence
92-136RGDERAPARPRAPRDGRGRQLRRHQPRGRREHMARRARGARHRPA
Subcellular Location(s) nucl 12, mito 9, cyto 4
Family & Domain DBs
Amino Acid Sequences QMRSRVTVCKRLNLKCDRRTPCGSYLKRDSTARCIYSAAAAEKVDVQSLRNRLMNVEGTLEQLTTGSPAQFKAPFGVQPGSGGCARIRNPLRGDERAPARPRAPRDGRGRQLRRHQPRGRREHMARRARGARHRPAHACCRPYHKHEPSSKRRAPAHSGLGCAPGPDRGVLRARGIAAAGDAGAACAAPLALSAATAPERAGRHDAAAPVLQRAPLCAARRGDVCVGRECR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.74
3 0.81
4 0.78
5 0.77
6 0.77
7 0.73
8 0.71
9 0.72
10 0.67
11 0.66
12 0.68
13 0.67
14 0.65
15 0.64
16 0.58
17 0.56
18 0.6
19 0.53
20 0.44
21 0.39
22 0.34
23 0.32
24 0.32
25 0.25
26 0.19
27 0.18
28 0.17
29 0.18
30 0.18
31 0.17
32 0.14
33 0.13
34 0.17
35 0.21
36 0.24
37 0.24
38 0.24
39 0.23
40 0.26
41 0.27
42 0.22
43 0.22
44 0.18
45 0.18
46 0.18
47 0.17
48 0.13
49 0.1
50 0.09
51 0.08
52 0.08
53 0.07
54 0.07
55 0.08
56 0.11
57 0.12
58 0.13
59 0.14
60 0.14
61 0.14
62 0.17
63 0.18
64 0.15
65 0.15
66 0.15
67 0.15
68 0.14
69 0.14
70 0.11
71 0.14
72 0.15
73 0.22
74 0.25
75 0.27
76 0.29
77 0.35
78 0.39
79 0.38
80 0.39
81 0.36
82 0.38
83 0.41
84 0.42
85 0.38
86 0.36
87 0.38
88 0.4
89 0.44
90 0.44
91 0.44
92 0.51
93 0.56
94 0.61
95 0.67
96 0.69
97 0.66
98 0.71
99 0.73
100 0.74
101 0.76
102 0.74
103 0.73
104 0.77
105 0.8
106 0.75
107 0.73
108 0.7
109 0.7
110 0.73
111 0.72
112 0.64
113 0.61
114 0.62
115 0.58
116 0.61
117 0.59
118 0.58
119 0.55
120 0.59
121 0.58
122 0.57
123 0.62
124 0.58
125 0.54
126 0.47
127 0.5
128 0.49
129 0.53
130 0.58
131 0.55
132 0.58
133 0.64
134 0.72
135 0.73
136 0.8
137 0.76
138 0.72
139 0.7
140 0.67
141 0.64
142 0.6
143 0.6
144 0.51
145 0.48
146 0.42
147 0.39
148 0.34
149 0.28
150 0.21
151 0.14
152 0.12
153 0.11
154 0.11
155 0.12
156 0.16
157 0.17
158 0.18
159 0.19
160 0.19
161 0.18
162 0.17
163 0.14
164 0.1
165 0.09
166 0.07
167 0.05
168 0.04
169 0.04
170 0.03
171 0.03
172 0.03
173 0.02
174 0.02
175 0.02
176 0.02
177 0.04
178 0.04
179 0.04
180 0.04
181 0.06
182 0.07
183 0.07
184 0.08
185 0.11
186 0.12
187 0.16
188 0.2
189 0.19
190 0.21
191 0.24
192 0.25
193 0.23
194 0.26
195 0.23
196 0.22
197 0.22
198 0.22
199 0.19
200 0.19
201 0.21
202 0.25
203 0.27
204 0.31
205 0.32
206 0.35
207 0.36
208 0.39
209 0.41
210 0.39
211 0.39