FuNGI

M2PE29

Protein Details

Accession

M2PE29

Localization Confidence

Medium

Confidence Score

10.7

NoLS Segment(s)

Position	Sequence	Protein Nature
562-599	LTRLLRAVWVRKKTERKSKEKKERLRRIRRRFREHFQL	Basic

NLS Segment(s)

Position	Sequence
571-594	VRKKTERKSKEKKERLRRIRRRFR

Subcellular Location(s)

cyto_nucl 10.5, nucl 10, cyto 9, extr 3, mito 2, pero 2

Family & Domain DBs

InterPro	View protein in InterPro IPR016035 Acyl_Trfase/lysoPLipase IPR002642 LysoPLipase_cat_dom
Gene Ontology	GO:0004622 F:lysophospholipase activity GO:0102545 F:phosphatidyl phospholipase B activity GO:0009395 P:phospholipid catabolic process
Pfam	View protein in Pfam PF01735 PLA2_B
PROSITE	View protein in PROSITE PS51210 PLA2C

Amino Acid Sequences

MRSAFAAFIGVPVSEVDERDIPVVAIAGSGGGYRAMLNTLGALSAAHRLGFLDCVTYLSGVSGSCWALGAIYSGVAGSVDPDSAAAHVRDRIQTSYLDTATFDALINPPTNKHLQSGIIRKAAGPAGMVSLVDVYGTLISSRLFVPSNVRSLDPRWLSMHHFRLNVDAGTLPLPIFCAIQYATPPEQVQALKEVRQEKDKSGTLKEKGDLSRQEGHLEEQTRFLWYEFTPYEIGCDEIGAWIPSWALGRQFESGRNIERRPEISFTILMGIFGSAFCASLKLYFNEIRPTLQALPIQLIKWLEEIITDNERDLELIHPVFPDQLPNFLKGLDGQLRDGSPPDITERNSLAFMDAGADLNIPYYPLLRRNVDCIVALDASADSQDLWFTRAEDMAARRGLRTWPRGAGWPAQVQSADPTPGSGERAGNPSSAEEASNVKLARTQESALAKQTDKQEMTERRNLPEATDEGQPRAPPLSTCEVWIGSSRADETASCRLDDLDEETLLRRDGLGVVYIPLMPNDRAAPGFDPFVVSTWRREVSSTESDQLLTVSAANFSESKDKLTRLLRAVWVRKKTERKSKEKKERLRRIRRRFREHFQL

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.11
2	0.12
3	0.15
4	0.16
5	0.17
6	0.17
7	0.17
8	0.13
9	0.13
10	0.12
11	0.09
12	0.07
13	0.06
14	0.05
15	0.05
16	0.05
17	0.05
18	0.04
19	0.05
20	0.05
21	0.06
22	0.07
23	0.07
24	0.07
25	0.08
26	0.08
27	0.07
28	0.07
29	0.07
30	0.06
31	0.1
32	0.11
33	0.1
34	0.1
35	0.11
36	0.12
37	0.13
38	0.12
39	0.11
40	0.1
41	0.12
42	0.12
43	0.12
44	0.11
45	0.09
46	0.1
47	0.08
48	0.09
49	0.1
50	0.09
51	0.09
52	0.09
53	0.08
54	0.08
55	0.08
56	0.09
57	0.06
58	0.06
59	0.06
60	0.05
61	0.06
62	0.05
63	0.05
64	0.05
65	0.05
66	0.05
67	0.05
68	0.06
69	0.06
70	0.07
71	0.09
72	0.09
73	0.1
74	0.14
75	0.17
76	0.2
77	0.23
78	0.24
79	0.23
80	0.24
81	0.26
82	0.28
83	0.26
84	0.23
85	0.2
86	0.2
87	0.18
88	0.18
89	0.13
90	0.1
91	0.1
92	0.12
93	0.14
94	0.14
95	0.14
96	0.18
97	0.22
98	0.21
99	0.22
100	0.23
101	0.26
102	0.33
103	0.41
104	0.43
105	0.42
106	0.41
107	0.39
108	0.4
109	0.35
110	0.27
111	0.19
112	0.13
113	0.11
114	0.11
115	0.11
116	0.08
117	0.07
118	0.06
119	0.05
120	0.05
121	0.04
122	0.04
123	0.04
124	0.04
125	0.04
126	0.05
127	0.06
128	0.07
129	0.08
130	0.09
131	0.1
132	0.16
133	0.18
134	0.23
135	0.23
136	0.24
137	0.24
138	0.26
139	0.34
140	0.29
141	0.28
142	0.26
143	0.27
144	0.32
145	0.38
146	0.43
147	0.39
148	0.39
149	0.37
150	0.39
151	0.38
152	0.32
153	0.25
154	0.17
155	0.13
156	0.13
157	0.13
158	0.09
159	0.07
160	0.07
161	0.07
162	0.07
163	0.06
164	0.07
165	0.07
166	0.08
167	0.09
168	0.14
169	0.14
170	0.16
171	0.16
172	0.15
173	0.18
174	0.17
175	0.17
176	0.19
177	0.2
178	0.2
179	0.25
180	0.3
181	0.29
182	0.36
183	0.37
184	0.34
185	0.39
186	0.4
187	0.39
188	0.4
189	0.45
190	0.42
191	0.43
192	0.41
193	0.4
194	0.38
195	0.41
196	0.38
197	0.35
198	0.38
199	0.35
200	0.36
201	0.3
202	0.3
203	0.28
204	0.28
205	0.23
206	0.19
207	0.18
208	0.18
209	0.18
210	0.16
211	0.13
212	0.11
213	0.16
214	0.14
215	0.16
216	0.15
217	0.14
218	0.15
219	0.13
220	0.14
221	0.09
222	0.09
223	0.06
224	0.06
225	0.07
226	0.06
227	0.06
228	0.05
229	0.05
230	0.05
231	0.06
232	0.06
233	0.07
234	0.08
235	0.1
236	0.12
237	0.13
238	0.15
239	0.18
240	0.19
241	0.23
242	0.26
243	0.26
244	0.26
245	0.28
246	0.28
247	0.27
248	0.27
249	0.23
250	0.21
251	0.21
252	0.17
253	0.17
254	0.15
255	0.12
256	0.09
257	0.08
258	0.06
259	0.05
260	0.06
261	0.03
262	0.04
263	0.04
264	0.04
265	0.04
266	0.07
267	0.08
268	0.09
269	0.12
270	0.14
271	0.16
272	0.19
273	0.2
274	0.18
275	0.17
276	0.19
277	0.17
278	0.16
279	0.16
280	0.12
281	0.14
282	0.14
283	0.13
284	0.12
285	0.11
286	0.1
287	0.09
288	0.09
289	0.07
290	0.06
291	0.08
292	0.09
293	0.1
294	0.1
295	0.1
296	0.1
297	0.1
298	0.09
299	0.08
300	0.06
301	0.07
302	0.07
303	0.07
304	0.07
305	0.07
306	0.08
307	0.08
308	0.1
309	0.08
310	0.15
311	0.15
312	0.17
313	0.17
314	0.16
315	0.16
316	0.14
317	0.17
318	0.15
319	0.15
320	0.14
321	0.15
322	0.15
323	0.15
324	0.15
325	0.12
326	0.08
327	0.08
328	0.11
329	0.12
330	0.13
331	0.15
332	0.15
333	0.16
334	0.16
335	0.15
336	0.13
337	0.1
338	0.09
339	0.08
340	0.07
341	0.06
342	0.06
343	0.06
344	0.05
345	0.05
346	0.05
347	0.04
348	0.04
349	0.05
350	0.07
351	0.11
352	0.15
353	0.18
354	0.19
355	0.23
356	0.24
357	0.24
358	0.23
359	0.19
360	0.18
361	0.14
362	0.14
363	0.1
364	0.08
365	0.07
366	0.07
367	0.06
368	0.03
369	0.03
370	0.04
371	0.04
372	0.06
373	0.06
374	0.07
375	0.08
376	0.08
377	0.08
378	0.11
379	0.12
380	0.15
381	0.18
382	0.17
383	0.17
384	0.18
385	0.24
386	0.27
387	0.31
388	0.3
389	0.3
390	0.31
391	0.35
392	0.37
393	0.36
394	0.33
395	0.32
396	0.29
397	0.27
398	0.26
399	0.22
400	0.21
401	0.18
402	0.15
403	0.11
404	0.11
405	0.11
406	0.11
407	0.13
408	0.13
409	0.12
410	0.13
411	0.17
412	0.18
413	0.17
414	0.17
415	0.15
416	0.16
417	0.15
418	0.13
419	0.11
420	0.12
421	0.13
422	0.16
423	0.16
424	0.13
425	0.16
426	0.17
427	0.2
428	0.19
429	0.19
430	0.21
431	0.26
432	0.27
433	0.28
434	0.3
435	0.27
436	0.29
437	0.33
438	0.34
439	0.31
440	0.31
441	0.37
442	0.42
443	0.49
444	0.53
445	0.51
446	0.47
447	0.52
448	0.5
449	0.42
450	0.38
451	0.34
452	0.27
453	0.31
454	0.29
455	0.25
456	0.27
457	0.26
458	0.23
459	0.22
460	0.2
461	0.15
462	0.19
463	0.23
464	0.22
465	0.23
466	0.24
467	0.22
468	0.23
469	0.25
470	0.21
471	0.14
472	0.15
473	0.14
474	0.13
475	0.13
476	0.12
477	0.14
478	0.21
479	0.22
480	0.21
481	0.2
482	0.2
483	0.2
484	0.21
485	0.21
486	0.15
487	0.14
488	0.15
489	0.16
490	0.17
491	0.17
492	0.15
493	0.11
494	0.09
495	0.1
496	0.1
497	0.1
498	0.09
499	0.1
500	0.11
501	0.11
502	0.1
503	0.1
504	0.12
505	0.11
506	0.13
507	0.13
508	0.14
509	0.14
510	0.16
511	0.17
512	0.16
513	0.17
514	0.16
515	0.17
516	0.16
517	0.17
518	0.19
519	0.19
520	0.2
521	0.24
522	0.26
523	0.25
524	0.25
525	0.27
526	0.3
527	0.36
528	0.36
529	0.34
530	0.33
531	0.32
532	0.31
533	0.28
534	0.21
535	0.14
536	0.11
537	0.09
538	0.09
539	0.09
540	0.1
541	0.1
542	0.11
543	0.18
544	0.18
545	0.23
546	0.26
547	0.27
548	0.33
549	0.38
550	0.44
551	0.41
552	0.46
553	0.48
554	0.54
555	0.63
556	0.65
557	0.67
558	0.67
559	0.73
560	0.78
561	0.8
562	0.81
563	0.82
564	0.84
565	0.87
566	0.92
567	0.93
568	0.94
569	0.95
570	0.95
571	0.96
572	0.96
573	0.96
574	0.96
575	0.96
576	0.96
577	0.96
578	0.96
579	0.93

M2PE29

3D AlphaFold-predicted Structure Viewer