Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B0DNS0

Protein Details
Accession B0DNS0    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
184-244GKKRMFKGHKWERVKAHRERRQNILMRDMKKRVYNYKNYYKRRRPNPLKPPRTTKAPKLPFBasic
NLS Segment(s)
PositionSequence
181-241LYAGKKRMFKGHKWERVKAHRERRQNILMRDMKKRVYNYKNYYKRRRPNPLKPPRTTKAPK
Subcellular Location(s) mito 15.5, cyto_mito 10.333, nucl 7.5, cyto_nucl 6.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR037507  MrpL25  
IPR040922  MRPL25_dom  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
KEGG lbc:LACBIDRAFT_306808  -  
Pfam View protein in Pfam  
PF18126  Mitoc_mL59  
Amino Acid Sequences MSAVAAAAKQAVKRFRYREFEGALSHEKRFGQPPEITNPSTDWHLWRVPNPFVPWRHPKNGRYHQPKYSLRRQVELVKKARISGTLHLLPPGIKTPKYVVPPPVETPAAPTPEVAETSAGATEVEKQMSKKKLLVKRLDKFFDRLSEAPFDWYVGQGREEREEARVKKVLEKPGAELGTRLYAGKKRMFKGHKWERVKAHRERRQNILMRDMKKRVYNYKNYYKRRRPNPLKPPRTTKAPKLPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.51
3 0.57
4 0.61
5 0.63
6 0.6
7 0.58
8 0.51
9 0.51
10 0.5
11 0.45
12 0.39
13 0.36
14 0.32
15 0.32
16 0.37
17 0.35
18 0.34
19 0.36
20 0.39
21 0.44
22 0.48
23 0.46
24 0.4
25 0.38
26 0.33
27 0.31
28 0.28
29 0.23
30 0.22
31 0.26
32 0.27
33 0.3
34 0.34
35 0.34
36 0.38
37 0.4
38 0.42
39 0.41
40 0.47
41 0.52
42 0.54
43 0.6
44 0.63
45 0.65
46 0.69
47 0.75
48 0.78
49 0.78
50 0.78
51 0.75
52 0.77
53 0.79
54 0.76
55 0.76
56 0.74
57 0.66
58 0.63
59 0.59
60 0.59
61 0.59
62 0.6
63 0.55
64 0.51
65 0.49
66 0.47
67 0.44
68 0.39
69 0.33
70 0.27
71 0.29
72 0.26
73 0.26
74 0.25
75 0.25
76 0.21
77 0.19
78 0.22
79 0.18
80 0.15
81 0.16
82 0.19
83 0.24
84 0.27
85 0.29
86 0.29
87 0.3
88 0.33
89 0.34
90 0.34
91 0.29
92 0.25
93 0.27
94 0.25
95 0.23
96 0.2
97 0.17
98 0.15
99 0.15
100 0.16
101 0.11
102 0.08
103 0.06
104 0.07
105 0.07
106 0.05
107 0.05
108 0.04
109 0.06
110 0.06
111 0.07
112 0.07
113 0.08
114 0.15
115 0.19
116 0.2
117 0.23
118 0.3
119 0.36
120 0.44
121 0.53
122 0.56
123 0.6
124 0.66
125 0.65
126 0.59
127 0.55
128 0.49
129 0.42
130 0.37
131 0.3
132 0.26
133 0.25
134 0.23
135 0.22
136 0.2
137 0.18
138 0.13
139 0.13
140 0.13
141 0.1
142 0.12
143 0.12
144 0.14
145 0.15
146 0.16
147 0.16
148 0.18
149 0.25
150 0.25
151 0.28
152 0.31
153 0.3
154 0.37
155 0.42
156 0.46
157 0.44
158 0.44
159 0.41
160 0.44
161 0.44
162 0.36
163 0.3
164 0.24
165 0.2
166 0.2
167 0.17
168 0.14
169 0.16
170 0.21
171 0.28
172 0.33
173 0.34
174 0.44
175 0.49
176 0.53
177 0.6
178 0.66
179 0.69
180 0.7
181 0.74
182 0.74
183 0.79
184 0.81
185 0.8
186 0.8
187 0.79
188 0.82
189 0.79
190 0.78
191 0.77
192 0.76
193 0.69
194 0.69
195 0.68
196 0.63
197 0.66
198 0.63
199 0.58
200 0.56
201 0.59
202 0.59
203 0.61
204 0.67
205 0.68
206 0.74
207 0.79
208 0.84
209 0.89
210 0.89
211 0.9
212 0.9
213 0.92
214 0.92
215 0.93
216 0.94
217 0.94
218 0.93
219 0.92
220 0.91
221 0.86
222 0.86
223 0.83
224 0.82