Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2PLV7

Protein Details
Accession M2PLV7   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
112-141QAEAKTSKNRAKRQKKKERARGERDKSKEPBasic
NLS Segment(s)
PositionSequence
116-143KTSKNRAKRQKKKERARGERDKSKEPEG
Subcellular Location(s) nucl 17, cyto 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009548  Prkrip1  
Gene Ontology GO:0003725  F:double-stranded RNA binding  
Pfam View protein in Pfam  
PF06658  DUF1168  
Amino Acid Sequences MSKSPTPQPAPAGAVRHGTVYDRQKAQLEKLLKDPSKPVNIPQPPKEKAIRPPREMMKNVQGSSAGAGSGEFHVYKASRRREYERLKMMEEEAQKETELREFEQKKRSWEQQAEAKTSKNRAKRQKKKERARGERDKSKEPEGDGVAPRGNTPDVPLKKRRLVSGKELVFRRPGEESEGEEEEVGPIPLQLTKDAEPASAELPAVPVIDAPRIIIHEDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.32
3 0.29
4 0.26
5 0.24
6 0.27
7 0.31
8 0.36
9 0.35
10 0.37
11 0.41
12 0.44
13 0.45
14 0.45
15 0.43
16 0.38
17 0.43
18 0.5
19 0.46
20 0.46
21 0.47
22 0.47
23 0.5
24 0.49
25 0.46
26 0.47
27 0.54
28 0.59
29 0.61
30 0.63
31 0.57
32 0.61
33 0.62
34 0.57
35 0.59
36 0.63
37 0.63
38 0.59
39 0.64
40 0.66
41 0.69
42 0.66
43 0.62
44 0.6
45 0.58
46 0.53
47 0.46
48 0.39
49 0.31
50 0.29
51 0.23
52 0.13
53 0.07
54 0.06
55 0.06
56 0.06
57 0.07
58 0.06
59 0.06
60 0.08
61 0.08
62 0.14
63 0.21
64 0.29
65 0.34
66 0.39
67 0.45
68 0.53
69 0.61
70 0.65
71 0.65
72 0.6
73 0.55
74 0.52
75 0.47
76 0.42
77 0.36
78 0.3
79 0.23
80 0.2
81 0.18
82 0.18
83 0.17
84 0.14
85 0.13
86 0.12
87 0.19
88 0.22
89 0.27
90 0.35
91 0.37
92 0.39
93 0.43
94 0.47
95 0.46
96 0.45
97 0.44
98 0.43
99 0.45
100 0.44
101 0.41
102 0.38
103 0.33
104 0.37
105 0.39
106 0.41
107 0.46
108 0.52
109 0.62
110 0.7
111 0.79
112 0.83
113 0.88
114 0.91
115 0.93
116 0.93
117 0.92
118 0.92
119 0.92
120 0.89
121 0.88
122 0.82
123 0.79
124 0.71
125 0.66
126 0.58
127 0.48
128 0.43
129 0.36
130 0.36
131 0.29
132 0.27
133 0.23
134 0.21
135 0.2
136 0.17
137 0.15
138 0.11
139 0.13
140 0.2
141 0.25
142 0.31
143 0.38
144 0.43
145 0.49
146 0.52
147 0.56
148 0.55
149 0.54
150 0.57
151 0.59
152 0.58
153 0.58
154 0.57
155 0.52
156 0.49
157 0.44
158 0.38
159 0.31
160 0.27
161 0.26
162 0.26
163 0.27
164 0.27
165 0.28
166 0.26
167 0.23
168 0.22
169 0.17
170 0.16
171 0.13
172 0.08
173 0.06
174 0.07
175 0.09
176 0.09
177 0.1
178 0.13
179 0.14
180 0.19
181 0.19
182 0.19
183 0.18
184 0.19
185 0.18
186 0.15
187 0.14
188 0.1
189 0.1
190 0.1
191 0.1
192 0.08
193 0.08
194 0.09
195 0.11
196 0.11
197 0.11
198 0.12
199 0.13