Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2RTQ7

Protein Details
Accession M2RTQ7    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MSSRRQRSYSRDRSRSPEHDRSRGRSRSHydrophilic
178-201HVAERDYERKRKRKEDKERLEEVVBasic
NLS Segment(s)
PositionSequence
186-220RKRKRKEDKERLEEVVGPKEVGREGMLEKKRAKRE
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR044688  SCI-1-like  
Amino Acid Sequences MSSRRQRSYSRDRSRSPEHDRSRGRSRSRSLDVPIPAGASPISESDYFLRSDEFRVWLKDEKHKYFDELSSDKARKYFRKFVKAWNRGKLPKSLYSGDISQPASSQTGYKWSFTSKTSRADNDALRAAREEVGAATYHRSSRSESGPSAASASGRIQGPTLPSQSDITLAREAADESHVAERDYERKRKRKEDKERLEEVVGPKEVGREGMLEKKRAKRETDRAFREKGDDGLDMDDSTLMGGGDSFRERIARRDAARQRFEKRGGATDEKVAAARERADAIRQKEKTTMDMFMQMAKEKFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.82
3 0.81
4 0.8
5 0.77
6 0.78
7 0.8
8 0.8
9 0.8
10 0.8
11 0.78
12 0.77
13 0.75
14 0.75
15 0.74
16 0.72
17 0.66
18 0.64
19 0.58
20 0.52
21 0.45
22 0.37
23 0.3
24 0.25
25 0.2
26 0.13
27 0.11
28 0.1
29 0.12
30 0.1
31 0.12
32 0.14
33 0.15
34 0.15
35 0.15
36 0.16
37 0.14
38 0.17
39 0.18
40 0.2
41 0.2
42 0.22
43 0.26
44 0.3
45 0.34
46 0.42
47 0.48
48 0.5
49 0.52
50 0.51
51 0.52
52 0.49
53 0.46
54 0.44
55 0.36
56 0.35
57 0.39
58 0.4
59 0.37
60 0.37
61 0.41
62 0.42
63 0.48
64 0.54
65 0.54
66 0.63
67 0.64
68 0.7
69 0.75
70 0.77
71 0.76
72 0.75
73 0.74
74 0.71
75 0.71
76 0.67
77 0.61
78 0.57
79 0.55
80 0.48
81 0.42
82 0.38
83 0.37
84 0.32
85 0.31
86 0.25
87 0.2
88 0.18
89 0.17
90 0.15
91 0.13
92 0.12
93 0.08
94 0.16
95 0.17
96 0.18
97 0.18
98 0.19
99 0.21
100 0.23
101 0.3
102 0.25
103 0.3
104 0.33
105 0.34
106 0.36
107 0.38
108 0.37
109 0.32
110 0.33
111 0.27
112 0.24
113 0.23
114 0.19
115 0.16
116 0.15
117 0.12
118 0.07
119 0.07
120 0.07
121 0.07
122 0.08
123 0.08
124 0.09
125 0.1
126 0.11
127 0.12
128 0.15
129 0.18
130 0.2
131 0.19
132 0.2
133 0.2
134 0.19
135 0.18
136 0.14
137 0.11
138 0.09
139 0.09
140 0.1
141 0.09
142 0.09
143 0.08
144 0.09
145 0.11
146 0.13
147 0.13
148 0.11
149 0.12
150 0.12
151 0.12
152 0.14
153 0.12
154 0.13
155 0.12
156 0.12
157 0.11
158 0.11
159 0.1
160 0.09
161 0.09
162 0.06
163 0.07
164 0.09
165 0.09
166 0.09
167 0.1
168 0.1
169 0.18
170 0.25
171 0.32
172 0.39
173 0.48
174 0.56
175 0.66
176 0.75
177 0.79
178 0.84
179 0.86
180 0.88
181 0.87
182 0.84
183 0.76
184 0.67
185 0.59
186 0.5
187 0.44
188 0.33
189 0.25
190 0.2
191 0.18
192 0.17
193 0.14
194 0.12
195 0.09
196 0.1
197 0.19
198 0.22
199 0.27
200 0.33
201 0.4
202 0.48
203 0.51
204 0.56
205 0.56
206 0.64
207 0.69
208 0.74
209 0.75
210 0.72
211 0.7
212 0.65
213 0.59
214 0.5
215 0.42
216 0.34
217 0.26
218 0.21
219 0.2
220 0.19
221 0.15
222 0.13
223 0.11
224 0.08
225 0.07
226 0.06
227 0.04
228 0.04
229 0.04
230 0.04
231 0.06
232 0.07
233 0.08
234 0.08
235 0.13
236 0.14
237 0.19
238 0.26
239 0.32
240 0.33
241 0.44
242 0.53
243 0.59
244 0.66
245 0.68
246 0.67
247 0.68
248 0.69
249 0.65
250 0.59
251 0.57
252 0.55
253 0.55
254 0.51
255 0.47
256 0.44
257 0.39
258 0.36
259 0.3
260 0.25
261 0.2
262 0.2
263 0.17
264 0.19
265 0.19
266 0.26
267 0.32
268 0.36
269 0.44
270 0.45
271 0.45
272 0.48
273 0.49
274 0.48
275 0.44
276 0.41
277 0.33
278 0.36
279 0.34
280 0.32
281 0.32
282 0.31