Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2QXX7

Protein Details
Accession M2QXX7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
226-245GEQWIKWSKKTPYKLFPGIFHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9, mito 8, extr 5, E.R. 4, mito_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007269  ICMT_MeTrfase  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0004671  F:protein C-terminal S-isoprenylcysteine carboxyl O-methyltransferase activity  
GO:0006481  P:C-terminal protein methylation  
Pfam View protein in Pfam  
PF04140  ICMT  
Amino Acid Sequences MTDTMQHLLLKAALILSGEFASHLAYSQPQSTNPDSEERQKYTSKTGDFAGRSFKVLRRGLGVCYLSLGLAETAVLLAHAFPSPLSERIIATLCPKIPDVSKLMITPAFLVAWVSSVAGCTIRLACHRKLGRFFTHQLAIRKDHKLITSGPYAIVRHPSYTGALLNLTGFMVLLLGRNSYVQECGMLTYPVGKIIIGLGVAGPVAGMLMLVMRTSVEDQVLKGEFGEQWIKWSKKTPYKLFPGIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.07
5 0.07
6 0.07
7 0.07
8 0.07
9 0.07
10 0.07
11 0.07
12 0.09
13 0.12
14 0.16
15 0.18
16 0.19
17 0.25
18 0.28
19 0.3
20 0.3
21 0.34
22 0.33
23 0.4
24 0.45
25 0.43
26 0.44
27 0.45
28 0.45
29 0.47
30 0.5
31 0.43
32 0.37
33 0.37
34 0.4
35 0.37
36 0.36
37 0.36
38 0.3
39 0.3
40 0.32
41 0.32
42 0.34
43 0.35
44 0.35
45 0.32
46 0.33
47 0.32
48 0.35
49 0.32
50 0.23
51 0.22
52 0.2
53 0.15
54 0.13
55 0.12
56 0.06
57 0.05
58 0.05
59 0.03
60 0.03
61 0.03
62 0.03
63 0.02
64 0.03
65 0.03
66 0.04
67 0.04
68 0.04
69 0.06
70 0.08
71 0.1
72 0.11
73 0.11
74 0.12
75 0.13
76 0.15
77 0.13
78 0.13
79 0.15
80 0.14
81 0.14
82 0.15
83 0.14
84 0.14
85 0.16
86 0.17
87 0.15
88 0.16
89 0.15
90 0.16
91 0.15
92 0.14
93 0.12
94 0.1
95 0.08
96 0.06
97 0.06
98 0.05
99 0.05
100 0.05
101 0.04
102 0.04
103 0.04
104 0.04
105 0.04
106 0.04
107 0.04
108 0.05
109 0.06
110 0.11
111 0.15
112 0.16
113 0.23
114 0.26
115 0.29
116 0.34
117 0.38
118 0.38
119 0.38
120 0.4
121 0.36
122 0.38
123 0.39
124 0.39
125 0.37
126 0.37
127 0.37
128 0.36
129 0.35
130 0.32
131 0.28
132 0.26
133 0.25
134 0.23
135 0.21
136 0.2
137 0.19
138 0.19
139 0.18
140 0.17
141 0.21
142 0.18
143 0.16
144 0.17
145 0.17
146 0.16
147 0.16
148 0.16
149 0.11
150 0.1
151 0.09
152 0.08
153 0.08
154 0.06
155 0.05
156 0.04
157 0.03
158 0.03
159 0.03
160 0.04
161 0.04
162 0.05
163 0.05
164 0.06
165 0.07
166 0.07
167 0.08
168 0.07
169 0.08
170 0.08
171 0.09
172 0.1
173 0.09
174 0.09
175 0.1
176 0.1
177 0.11
178 0.11
179 0.09
180 0.08
181 0.08
182 0.09
183 0.06
184 0.06
185 0.04
186 0.04
187 0.04
188 0.04
189 0.03
190 0.02
191 0.02
192 0.02
193 0.02
194 0.02
195 0.02
196 0.03
197 0.03
198 0.03
199 0.03
200 0.05
201 0.07
202 0.08
203 0.1
204 0.1
205 0.11
206 0.15
207 0.17
208 0.15
209 0.14
210 0.15
211 0.13
212 0.16
213 0.21
214 0.16
215 0.21
216 0.3
217 0.32
218 0.33
219 0.41
220 0.47
221 0.52
222 0.63
223 0.66
224 0.67
225 0.74