Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2R7Y3

Protein Details
Accession M2R7Y3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
246-275EVFAEHVPTKKKKKLWRRKDQPKFEYPYKEBasic
NLS Segment(s)
PositionSequence
255-265KKKKKLWRRKD
Subcellular Location(s) mito 20.5, mito_nucl 11.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009446  Mgm101  
Gene Ontology GO:0000262  C:mitochondrial chromosome  
GO:0003697  F:single-stranded DNA binding  
GO:0006281  P:DNA repair  
GO:0000002  P:mitochondrial genome maintenance  
Pfam View protein in Pfam  
PF06420  Mgm101p  
Amino Acid Sequences MASRLLLSGSRALRPLPFSAPRARTYAAAATRTRKTAAAAAPAQPVARASTVSAPPTTADEIDEALASESGPAESVPSSSTIRPPQQPFSAELPEQSVGEPAMDWSKSYHGLSQQPFPKEISDILMAPIDPLDIEMKPDGLIYLPEIKYRRVLNRAFGPGAWGLAPRSDTNVGPRIVSREYALVCMGRLVAIARGEQEYFDPSGIPTATEACKSNALMRCCKDLGIASELWDPRFIREFKAQYCIEVFAEHVPTKKKKKLWRRKDQPKFEYPYKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.3
4 0.32
5 0.35
6 0.43
7 0.46
8 0.46
9 0.47
10 0.45
11 0.39
12 0.37
13 0.4
14 0.36
15 0.37
16 0.38
17 0.39
18 0.42
19 0.43
20 0.4
21 0.34
22 0.31
23 0.32
24 0.32
25 0.33
26 0.33
27 0.33
28 0.34
29 0.34
30 0.31
31 0.25
32 0.22
33 0.16
34 0.14
35 0.12
36 0.11
37 0.16
38 0.19
39 0.21
40 0.2
41 0.18
42 0.18
43 0.21
44 0.21
45 0.15
46 0.13
47 0.12
48 0.12
49 0.12
50 0.11
51 0.08
52 0.07
53 0.07
54 0.06
55 0.06
56 0.05
57 0.05
58 0.05
59 0.04
60 0.05
61 0.05
62 0.06
63 0.06
64 0.08
65 0.11
66 0.11
67 0.17
68 0.22
69 0.26
70 0.33
71 0.36
72 0.39
73 0.41
74 0.41
75 0.41
76 0.4
77 0.39
78 0.32
79 0.29
80 0.27
81 0.23
82 0.22
83 0.17
84 0.13
85 0.09
86 0.09
87 0.08
88 0.06
89 0.08
90 0.07
91 0.07
92 0.08
93 0.09
94 0.12
95 0.12
96 0.14
97 0.15
98 0.22
99 0.24
100 0.29
101 0.33
102 0.32
103 0.33
104 0.32
105 0.28
106 0.23
107 0.21
108 0.17
109 0.13
110 0.12
111 0.11
112 0.1
113 0.1
114 0.08
115 0.08
116 0.05
117 0.04
118 0.04
119 0.05
120 0.04
121 0.05
122 0.05
123 0.06
124 0.06
125 0.06
126 0.05
127 0.04
128 0.04
129 0.05
130 0.11
131 0.11
132 0.14
133 0.15
134 0.16
135 0.19
136 0.23
137 0.26
138 0.27
139 0.28
140 0.3
141 0.35
142 0.37
143 0.34
144 0.31
145 0.28
146 0.22
147 0.21
148 0.16
149 0.11
150 0.08
151 0.08
152 0.1
153 0.08
154 0.11
155 0.12
156 0.12
157 0.16
158 0.21
159 0.2
160 0.19
161 0.19
162 0.2
163 0.19
164 0.2
165 0.16
166 0.14
167 0.14
168 0.15
169 0.15
170 0.12
171 0.11
172 0.1
173 0.09
174 0.06
175 0.06
176 0.05
177 0.07
178 0.07
179 0.08
180 0.08
181 0.1
182 0.1
183 0.1
184 0.1
185 0.11
186 0.11
187 0.11
188 0.1
189 0.08
190 0.11
191 0.11
192 0.1
193 0.08
194 0.11
195 0.12
196 0.13
197 0.15
198 0.14
199 0.17
200 0.17
201 0.24
202 0.27
203 0.3
204 0.36
205 0.37
206 0.4
207 0.38
208 0.38
209 0.32
210 0.29
211 0.28
212 0.25
213 0.22
214 0.19
215 0.25
216 0.26
217 0.25
218 0.26
219 0.22
220 0.22
221 0.29
222 0.27
223 0.27
224 0.34
225 0.4
226 0.38
227 0.46
228 0.43
229 0.38
230 0.39
231 0.36
232 0.28
233 0.23
234 0.22
235 0.17
236 0.22
237 0.21
238 0.24
239 0.29
240 0.38
241 0.46
242 0.53
243 0.58
244 0.64
245 0.74
246 0.81
247 0.85
248 0.87
249 0.9
250 0.93
251 0.96
252 0.96
253 0.94
254 0.93
255 0.9