Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2PE47

Protein Details
Accession M2PE47   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
297-316KRSRAMEKRKRELEERRRLLBasic
NLS Segment(s)
PositionSequence
297-327KRSRAMEKRKRELEERRRLLDAKRRKTGKGS
Subcellular Location(s) cyto 14.5, cyto_nucl 14, nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025066  CCDC174-like  
Pfam View protein in Pfam  
PF13300  DUF4078  
Amino Acid Sequences MPPRDKSKAAGVSASSFFDLKAELAKKEEEFTKAKAAGKATALVGGVKRPDKKPTVWARQNSGVKSRAARDIELEAVDRPTLEAAQAKLQRKAEIYEKLMRGKSGGLSEKQLDTLLVDFDQKAADHYESDSDDVDESLTVPGPPGGAGDDPVIEYEDEFGRVRTARRSEVPRHLLPASERDEQDDEDDFDPYVIHNPVDHFPVYEPSAERVEAIQKEFSEENNPLNIHYDAAREVRAKGAGFYQFSGDEETRQRQMEELRRAREETERTRQDTGALDVRPGELEGMRAPEADAVGIKRSRAMEKRKRELEERRRLLDAKRRKTGKGSAPPDEPEPGPPPPPLVAEQNAVAPRTDPFAMLEAAAPTGSIGKGKGKETVTVDPADAFLAQLERDVLKRVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.3
3 0.23
4 0.2
5 0.17
6 0.16
7 0.11
8 0.17
9 0.19
10 0.19
11 0.22
12 0.25
13 0.26
14 0.29
15 0.32
16 0.3
17 0.31
18 0.32
19 0.37
20 0.39
21 0.42
22 0.42
23 0.41
24 0.39
25 0.37
26 0.37
27 0.29
28 0.26
29 0.22
30 0.21
31 0.19
32 0.18
33 0.22
34 0.25
35 0.31
36 0.32
37 0.4
38 0.43
39 0.45
40 0.52
41 0.58
42 0.63
43 0.66
44 0.7
45 0.69
46 0.73
47 0.76
48 0.69
49 0.65
50 0.57
51 0.52
52 0.5
53 0.46
54 0.45
55 0.41
56 0.37
57 0.34
58 0.33
59 0.31
60 0.28
61 0.25
62 0.18
63 0.17
64 0.16
65 0.13
66 0.11
67 0.09
68 0.08
69 0.09
70 0.11
71 0.11
72 0.19
73 0.26
74 0.29
75 0.34
76 0.36
77 0.37
78 0.36
79 0.38
80 0.37
81 0.37
82 0.38
83 0.41
84 0.42
85 0.46
86 0.45
87 0.42
88 0.36
89 0.31
90 0.28
91 0.26
92 0.28
93 0.23
94 0.26
95 0.28
96 0.27
97 0.26
98 0.24
99 0.18
100 0.14
101 0.13
102 0.1
103 0.08
104 0.09
105 0.08
106 0.08
107 0.09
108 0.08
109 0.09
110 0.1
111 0.1
112 0.1
113 0.1
114 0.12
115 0.12
116 0.13
117 0.12
118 0.11
119 0.1
120 0.1
121 0.09
122 0.07
123 0.07
124 0.06
125 0.06
126 0.05
127 0.05
128 0.05
129 0.05
130 0.05
131 0.05
132 0.05
133 0.05
134 0.06
135 0.06
136 0.06
137 0.06
138 0.07
139 0.07
140 0.06
141 0.06
142 0.06
143 0.06
144 0.08
145 0.08
146 0.08
147 0.09
148 0.11
149 0.12
150 0.17
151 0.2
152 0.21
153 0.27
154 0.34
155 0.39
156 0.47
157 0.51
158 0.46
159 0.47
160 0.44
161 0.39
162 0.34
163 0.33
164 0.29
165 0.26
166 0.25
167 0.24
168 0.25
169 0.24
170 0.24
171 0.19
172 0.17
173 0.13
174 0.14
175 0.11
176 0.1
177 0.09
178 0.08
179 0.09
180 0.07
181 0.07
182 0.07
183 0.09
184 0.1
185 0.12
186 0.12
187 0.1
188 0.1
189 0.12
190 0.12
191 0.12
192 0.11
193 0.11
194 0.13
195 0.12
196 0.12
197 0.1
198 0.14
199 0.14
200 0.15
201 0.14
202 0.13
203 0.16
204 0.16
205 0.16
206 0.15
207 0.15
208 0.15
209 0.16
210 0.16
211 0.14
212 0.16
213 0.16
214 0.13
215 0.12
216 0.12
217 0.11
218 0.12
219 0.14
220 0.12
221 0.12
222 0.13
223 0.14
224 0.13
225 0.12
226 0.15
227 0.15
228 0.15
229 0.15
230 0.15
231 0.13
232 0.14
233 0.17
234 0.14
235 0.14
236 0.17
237 0.19
238 0.21
239 0.21
240 0.21
241 0.19
242 0.26
243 0.32
244 0.39
245 0.43
246 0.44
247 0.46
248 0.47
249 0.46
250 0.46
251 0.44
252 0.42
253 0.45
254 0.47
255 0.48
256 0.49
257 0.48
258 0.43
259 0.38
260 0.34
261 0.29
262 0.24
263 0.21
264 0.19
265 0.19
266 0.17
267 0.15
268 0.12
269 0.07
270 0.08
271 0.08
272 0.11
273 0.11
274 0.1
275 0.1
276 0.1
277 0.1
278 0.09
279 0.09
280 0.08
281 0.12
282 0.13
283 0.13
284 0.15
285 0.17
286 0.25
287 0.32
288 0.42
289 0.47
290 0.57
291 0.67
292 0.72
293 0.75
294 0.76
295 0.79
296 0.79
297 0.8
298 0.77
299 0.7
300 0.67
301 0.65
302 0.63
303 0.62
304 0.62
305 0.6
306 0.63
307 0.63
308 0.62
309 0.66
310 0.68
311 0.68
312 0.68
313 0.66
314 0.63
315 0.63
316 0.62
317 0.58
318 0.52
319 0.43
320 0.37
321 0.34
322 0.3
323 0.28
324 0.26
325 0.26
326 0.24
327 0.26
328 0.24
329 0.25
330 0.25
331 0.24
332 0.25
333 0.28
334 0.28
335 0.26
336 0.23
337 0.19
338 0.17
339 0.19
340 0.19
341 0.14
342 0.13
343 0.15
344 0.15
345 0.15
346 0.15
347 0.12
348 0.12
349 0.11
350 0.09
351 0.07
352 0.08
353 0.08
354 0.08
355 0.09
356 0.16
357 0.2
358 0.22
359 0.29
360 0.29
361 0.34
362 0.39
363 0.44
364 0.4
365 0.38
366 0.37
367 0.31
368 0.3
369 0.25
370 0.19
371 0.12
372 0.1
373 0.1
374 0.09
375 0.09
376 0.11
377 0.12
378 0.13