Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2PX57

Protein Details
Accession M2PX57   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
95-121ASSAPSSTDKKKKKKKNTQQVQSEPPAHydrophilic
NLS Segment(s)
PositionSequence
104-110KKKKKKK
Subcellular Location(s) mito 14, nucl 9, cyto_nucl 7, cyto 3
Family & Domain DBs
Amino Acid Sequences MAVPQGPVSAQQLRLTIAFAALRHKPPGQSFEAYVLDLQEKFLASAEAQREPPWRERALDLEKQLAGLKRKYEEEHIELISLRETQTGTQVSEPASSAPSSTDKKKKKKKNTQQVQSEPPAAPVESVPIKLTLRNVLLDSKTRSALPAVCSGDNVLSSLESLDTLLAVHTTNKSAVAPRALVLCL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.18
4 0.16
5 0.15
6 0.13
7 0.17
8 0.2
9 0.23
10 0.26
11 0.28
12 0.3
13 0.32
14 0.37
15 0.37
16 0.35
17 0.34
18 0.35
19 0.34
20 0.3
21 0.26
22 0.22
23 0.18
24 0.15
25 0.15
26 0.11
27 0.09
28 0.09
29 0.09
30 0.09
31 0.07
32 0.12
33 0.14
34 0.16
35 0.17
36 0.19
37 0.24
38 0.26
39 0.32
40 0.33
41 0.32
42 0.31
43 0.32
44 0.37
45 0.38
46 0.4
47 0.35
48 0.33
49 0.31
50 0.29
51 0.3
52 0.27
53 0.24
54 0.22
55 0.23
56 0.22
57 0.25
58 0.26
59 0.28
60 0.29
61 0.29
62 0.29
63 0.27
64 0.25
65 0.23
66 0.21
67 0.17
68 0.12
69 0.09
70 0.07
71 0.07
72 0.06
73 0.1
74 0.1
75 0.1
76 0.1
77 0.11
78 0.11
79 0.11
80 0.11
81 0.08
82 0.08
83 0.07
84 0.07
85 0.07
86 0.11
87 0.13
88 0.2
89 0.29
90 0.37
91 0.48
92 0.58
93 0.67
94 0.75
95 0.84
96 0.88
97 0.9
98 0.92
99 0.92
100 0.92
101 0.88
102 0.84
103 0.76
104 0.68
105 0.56
106 0.47
107 0.38
108 0.27
109 0.21
110 0.14
111 0.14
112 0.12
113 0.12
114 0.11
115 0.13
116 0.13
117 0.14
118 0.16
119 0.16
120 0.16
121 0.17
122 0.17
123 0.19
124 0.2
125 0.24
126 0.27
127 0.25
128 0.25
129 0.24
130 0.23
131 0.22
132 0.24
133 0.22
134 0.25
135 0.26
136 0.24
137 0.25
138 0.25
139 0.23
140 0.2
141 0.18
142 0.11
143 0.08
144 0.08
145 0.08
146 0.07
147 0.06
148 0.06
149 0.05
150 0.05
151 0.05
152 0.05
153 0.05
154 0.05
155 0.08
156 0.09
157 0.11
158 0.11
159 0.13
160 0.14
161 0.18
162 0.21
163 0.24
164 0.23
165 0.23