Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2RAP0

Protein Details
Accession M2RAP0   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
34-53ASACPPPRRPHKVLAPPPPHHydrophilic
NLS Segment(s)
PositionSequence
42-45RPHK
Subcellular Location(s) mito 14, nucl 10.5, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MGRRAGGIKGDARRMQSGQPHQPSAATPAPPRPASACPPPRRPHKVLAPPPPHPASTRPRHGRTSSSVSPEHQRASPPAVVGALPPRPRTYNYPMLARMHRARPRATQGYHRAVRDTPPVLMRDTTYDYPPPRHVLRPLPRHHVRMHLVPRRMRPSCDTLDSPLTPQWRNGAVPNWIWPVDPPLAFACRAPKPSHWPPPPLSIPRKPRLGPAPAPWPEEPHSPRLRQASTQSRNSPADPRLRGPRTRSNGGASCGLGRPGHDGIGQDLGSSCETIRPPAMCLPFALSRM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.45
3 0.48
4 0.52
5 0.54
6 0.57
7 0.56
8 0.52
9 0.51
10 0.47
11 0.44
12 0.4
13 0.34
14 0.3
15 0.35
16 0.41
17 0.4
18 0.4
19 0.37
20 0.37
21 0.39
22 0.47
23 0.5
24 0.52
25 0.61
26 0.68
27 0.74
28 0.78
29 0.77
30 0.75
31 0.76
32 0.78
33 0.78
34 0.81
35 0.78
36 0.73
37 0.75
38 0.69
39 0.6
40 0.51
41 0.49
42 0.48
43 0.49
44 0.56
45 0.58
46 0.6
47 0.66
48 0.66
49 0.64
50 0.62
51 0.61
52 0.56
53 0.52
54 0.49
55 0.45
56 0.48
57 0.45
58 0.41
59 0.34
60 0.31
61 0.28
62 0.31
63 0.3
64 0.24
65 0.21
66 0.19
67 0.17
68 0.16
69 0.18
70 0.18
71 0.19
72 0.21
73 0.23
74 0.24
75 0.27
76 0.33
77 0.36
78 0.4
79 0.4
80 0.43
81 0.44
82 0.46
83 0.45
84 0.44
85 0.42
86 0.41
87 0.44
88 0.43
89 0.43
90 0.44
91 0.5
92 0.51
93 0.49
94 0.49
95 0.51
96 0.57
97 0.57
98 0.52
99 0.46
100 0.4
101 0.41
102 0.37
103 0.3
104 0.23
105 0.21
106 0.22
107 0.21
108 0.2
109 0.18
110 0.16
111 0.19
112 0.18
113 0.17
114 0.2
115 0.21
116 0.23
117 0.25
118 0.26
119 0.24
120 0.25
121 0.27
122 0.33
123 0.4
124 0.47
125 0.49
126 0.54
127 0.56
128 0.57
129 0.54
130 0.51
131 0.45
132 0.44
133 0.49
134 0.46
135 0.48
136 0.48
137 0.52
138 0.53
139 0.52
140 0.47
141 0.41
142 0.4
143 0.37
144 0.37
145 0.33
146 0.28
147 0.3
148 0.29
149 0.26
150 0.23
151 0.24
152 0.2
153 0.2
154 0.19
155 0.18
156 0.18
157 0.19
158 0.19
159 0.18
160 0.19
161 0.21
162 0.2
163 0.19
164 0.18
165 0.16
166 0.17
167 0.16
168 0.16
169 0.14
170 0.14
171 0.15
172 0.15
173 0.16
174 0.18
175 0.19
176 0.22
177 0.23
178 0.25
179 0.33
180 0.41
181 0.51
182 0.5
183 0.53
184 0.53
185 0.58
186 0.61
187 0.6
188 0.59
189 0.57
190 0.62
191 0.62
192 0.66
193 0.59
194 0.59
195 0.57
196 0.57
197 0.53
198 0.5
199 0.54
200 0.5
201 0.54
202 0.48
203 0.45
204 0.4
205 0.44
206 0.42
207 0.41
208 0.43
209 0.41
210 0.46
211 0.48
212 0.48
213 0.43
214 0.49
215 0.52
216 0.53
217 0.59
218 0.58
219 0.58
220 0.58
221 0.56
222 0.54
223 0.49
224 0.51
225 0.46
226 0.48
227 0.52
228 0.55
229 0.59
230 0.59
231 0.64
232 0.63
233 0.64
234 0.62
235 0.59
236 0.57
237 0.54
238 0.5
239 0.4
240 0.35
241 0.31
242 0.3
243 0.23
244 0.19
245 0.21
246 0.19
247 0.2
248 0.18
249 0.18
250 0.17
251 0.22
252 0.21
253 0.16
254 0.15
255 0.16
256 0.15
257 0.15
258 0.13
259 0.13
260 0.14
261 0.17
262 0.21
263 0.2
264 0.23
265 0.29
266 0.33
267 0.29
268 0.29
269 0.31