Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2RRJ9

Protein Details
Accession M2RRJ9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
136-158DEPQPRPREEKDKKKAPREVTLGBasic
NLS Segment(s)
PositionSequence
140-152PRPREEKDKKKAP
Subcellular Location(s) mito 23, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040049  MRPS25  
IPR007741  Ribosome/NADH_DH  
IPR036249  Thioredoxin-like_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
Pfam View protein in Pfam  
PF05047  L51_S25_CI-B8  
Amino Acid Sequences MPRRPKPVLGPSRLSQVLANLNKAPRPELVNIKTLKLKYALRNDHIAARHFVKEELPRVRYANPALNIEINKVPKTKQEKWKPEMVVQFEDGSTKIVDMDKKWSTSIFQELLEVAGGTPWQRWKRERKASGLPLLDEPQPRPREEKDKKKAPREVTLGELFDTSKKGAAAVLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.41
3 0.35
4 0.37
5 0.33
6 0.35
7 0.31
8 0.33
9 0.34
10 0.34
11 0.32
12 0.25
13 0.27
14 0.29
15 0.34
16 0.35
17 0.4
18 0.4
19 0.41
20 0.44
21 0.4
22 0.37
23 0.32
24 0.35
25 0.35
26 0.44
27 0.48
28 0.46
29 0.5
30 0.49
31 0.5
32 0.47
33 0.41
34 0.35
35 0.31
36 0.3
37 0.26
38 0.25
39 0.24
40 0.25
41 0.3
42 0.33
43 0.32
44 0.32
45 0.33
46 0.34
47 0.33
48 0.32
49 0.31
50 0.27
51 0.27
52 0.26
53 0.26
54 0.25
55 0.23
56 0.24
57 0.19
58 0.19
59 0.18
60 0.18
61 0.22
62 0.31
63 0.37
64 0.44
65 0.53
66 0.61
67 0.63
68 0.7
69 0.65
70 0.61
71 0.57
72 0.5
73 0.41
74 0.33
75 0.29
76 0.22
77 0.2
78 0.15
79 0.12
80 0.08
81 0.06
82 0.06
83 0.07
84 0.09
85 0.09
86 0.15
87 0.16
88 0.17
89 0.18
90 0.17
91 0.17
92 0.18
93 0.21
94 0.16
95 0.15
96 0.14
97 0.14
98 0.14
99 0.12
100 0.1
101 0.06
102 0.04
103 0.04
104 0.04
105 0.06
106 0.13
107 0.18
108 0.22
109 0.29
110 0.4
111 0.51
112 0.61
113 0.65
114 0.65
115 0.71
116 0.74
117 0.75
118 0.67
119 0.58
120 0.5
121 0.47
122 0.43
123 0.35
124 0.31
125 0.32
126 0.32
127 0.32
128 0.34
129 0.38
130 0.45
131 0.54
132 0.62
133 0.64
134 0.72
135 0.8
136 0.85
137 0.87
138 0.83
139 0.82
140 0.77
141 0.7
142 0.66
143 0.61
144 0.52
145 0.43
146 0.37
147 0.29
148 0.24
149 0.22
150 0.17
151 0.14
152 0.13
153 0.13