Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2QA23

Protein Details
Accession M2QA23    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
175-219NPNPTKIKKACEGCRRRKRGCDGGGRKQCSRRMHVQYAKRESRKTHydrophilic
NLS Segment(s)
PositionSequence
153-157PRRKA
Subcellular Location(s) nucl 19.5, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
CDD cd00067  GAL4  
Amino Acid Sequences MNFPAACSGASMMAHLRGPLVVSTEEFVTLPQAYRDKLVKEATATSHEGGKKFDGLRTILHPKCYELYMRYNRDTGPNPSFHDDLKLLTQISISPALGRHEHYIDSANSADKKVPKLEYPERSGNRTNEVSLAASQTNVQLKTLPRGTKSASPRRKARSSRESLSACETIASGDNPNPTKIKKACEGCRRRKRGCDGGGRKQCSRRMHVQYAKRESRKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.12
4 0.1
5 0.11
6 0.11
7 0.12
8 0.11
9 0.11
10 0.12
11 0.12
12 0.13
13 0.12
14 0.11
15 0.11
16 0.11
17 0.11
18 0.13
19 0.16
20 0.16
21 0.2
22 0.23
23 0.23
24 0.27
25 0.29
26 0.27
27 0.27
28 0.29
29 0.27
30 0.28
31 0.28
32 0.24
33 0.27
34 0.27
35 0.26
36 0.25
37 0.24
38 0.25
39 0.23
40 0.24
41 0.22
42 0.21
43 0.22
44 0.27
45 0.35
46 0.32
47 0.35
48 0.33
49 0.32
50 0.32
51 0.31
52 0.28
53 0.22
54 0.3
55 0.35
56 0.39
57 0.39
58 0.39
59 0.38
60 0.41
61 0.41
62 0.38
63 0.34
64 0.31
65 0.32
66 0.34
67 0.35
68 0.29
69 0.29
70 0.23
71 0.19
72 0.18
73 0.16
74 0.13
75 0.12
76 0.12
77 0.09
78 0.1
79 0.1
80 0.08
81 0.07
82 0.08
83 0.1
84 0.11
85 0.12
86 0.12
87 0.12
88 0.12
89 0.13
90 0.14
91 0.13
92 0.13
93 0.12
94 0.12
95 0.12
96 0.12
97 0.13
98 0.13
99 0.15
100 0.16
101 0.17
102 0.17
103 0.25
104 0.32
105 0.35
106 0.39
107 0.46
108 0.45
109 0.48
110 0.5
111 0.44
112 0.41
113 0.37
114 0.31
115 0.24
116 0.23
117 0.19
118 0.15
119 0.15
120 0.1
121 0.09
122 0.09
123 0.11
124 0.14
125 0.13
126 0.13
127 0.14
128 0.15
129 0.21
130 0.26
131 0.26
132 0.24
133 0.27
134 0.3
135 0.34
136 0.43
137 0.48
138 0.51
139 0.56
140 0.63
141 0.68
142 0.75
143 0.75
144 0.76
145 0.75
146 0.74
147 0.71
148 0.72
149 0.65
150 0.58
151 0.56
152 0.46
153 0.35
154 0.28
155 0.23
156 0.15
157 0.15
158 0.14
159 0.1
160 0.12
161 0.18
162 0.19
163 0.21
164 0.24
165 0.23
166 0.31
167 0.33
168 0.36
169 0.39
170 0.47
171 0.55
172 0.63
173 0.73
174 0.75
175 0.82
176 0.87
177 0.86
178 0.86
179 0.85
180 0.85
181 0.83
182 0.83
183 0.81
184 0.83
185 0.85
186 0.82
187 0.79
188 0.76
189 0.75
190 0.71
191 0.69
192 0.68
193 0.67
194 0.72
195 0.75
196 0.77
197 0.8
198 0.83
199 0.86