Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2QXU1

Protein Details
Accession M2QXU1    Localization Confidence High Confidence Score 17.8
NoLS Segment(s)
PositionSequenceProtein Nature
132-154EQAIRKRRFEKKCKAARVDRRAQBasic
NLS Segment(s)
PositionSequence
136-166RKRRFEKKCKAARVDRRAQRKQEKRELVAPR
196-207PGRRGRSPSSSR
Subcellular Location(s) nucl 21, cyto 6
Family & Domain DBs
Amino Acid Sequences MLHNNNLFRRGADQVILRDTAGRLDYSYVYAQLRDFHAFDRRLRDGRFNPDHHPYPAGYERFVQLWNQDEDCPFGFMGFEEASVSLIATPRPAPSLNNLAPTPAAPAANAAAPQFAPEDQEVYQGALIVTAEQAIRKRRFEKKCKAARVDRRAQRKQEKRELVAPRRDYPRSHSSYSSRSNGPANSPSGSRSTSPPGRRGRSPSSSRKATRPSTPELSDKDAEGEPDNTEDTPMLEAGVAASEGTGSAGGGDNTSGNVSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.3
3 0.3
4 0.26
5 0.24
6 0.22
7 0.22
8 0.19
9 0.15
10 0.13
11 0.14
12 0.15
13 0.16
14 0.17
15 0.17
16 0.17
17 0.17
18 0.17
19 0.18
20 0.21
21 0.21
22 0.21
23 0.21
24 0.28
25 0.31
26 0.34
27 0.38
28 0.41
29 0.43
30 0.45
31 0.51
32 0.49
33 0.56
34 0.6
35 0.56
36 0.56
37 0.58
38 0.59
39 0.52
40 0.49
41 0.38
42 0.37
43 0.4
44 0.36
45 0.3
46 0.27
47 0.27
48 0.25
49 0.26
50 0.2
51 0.15
52 0.19
53 0.2
54 0.2
55 0.2
56 0.19
57 0.21
58 0.21
59 0.2
60 0.15
61 0.12
62 0.1
63 0.09
64 0.11
65 0.08
66 0.08
67 0.07
68 0.07
69 0.08
70 0.07
71 0.07
72 0.05
73 0.06
74 0.06
75 0.07
76 0.07
77 0.07
78 0.09
79 0.1
80 0.1
81 0.13
82 0.22
83 0.22
84 0.25
85 0.24
86 0.23
87 0.23
88 0.22
89 0.2
90 0.13
91 0.11
92 0.08
93 0.08
94 0.08
95 0.09
96 0.09
97 0.07
98 0.06
99 0.06
100 0.06
101 0.06
102 0.06
103 0.07
104 0.06
105 0.08
106 0.08
107 0.09
108 0.09
109 0.09
110 0.09
111 0.07
112 0.07
113 0.05
114 0.05
115 0.04
116 0.03
117 0.04
118 0.04
119 0.05
120 0.08
121 0.15
122 0.18
123 0.21
124 0.28
125 0.37
126 0.47
127 0.56
128 0.64
129 0.67
130 0.74
131 0.79
132 0.8
133 0.81
134 0.81
135 0.8
136 0.8
137 0.76
138 0.77
139 0.76
140 0.77
141 0.78
142 0.77
143 0.78
144 0.78
145 0.77
146 0.71
147 0.72
148 0.73
149 0.71
150 0.7
151 0.65
152 0.61
153 0.61
154 0.6
155 0.52
156 0.5
157 0.51
158 0.47
159 0.46
160 0.45
161 0.43
162 0.48
163 0.52
164 0.49
165 0.41
166 0.38
167 0.38
168 0.35
169 0.34
170 0.31
171 0.27
172 0.25
173 0.24
174 0.23
175 0.22
176 0.23
177 0.2
178 0.2
179 0.26
180 0.32
181 0.37
182 0.43
183 0.5
184 0.53
185 0.57
186 0.61
187 0.61
188 0.63
189 0.67
190 0.69
191 0.68
192 0.73
193 0.71
194 0.72
195 0.72
196 0.68
197 0.68
198 0.63
199 0.62
200 0.59
201 0.59
202 0.57
203 0.53
204 0.54
205 0.46
206 0.41
207 0.37
208 0.3
209 0.28
210 0.25
211 0.22
212 0.17
213 0.17
214 0.18
215 0.15
216 0.15
217 0.13
218 0.11
219 0.11
220 0.1
221 0.09
222 0.07
223 0.07
224 0.06
225 0.07
226 0.06
227 0.04
228 0.04
229 0.04
230 0.04
231 0.04
232 0.04
233 0.03
234 0.04
235 0.06
236 0.06
237 0.07
238 0.07
239 0.07
240 0.08