Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2PQL6

Protein Details
Accession M2PQL6    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
19-38ASSSCSPSSRQPRSRGSFIRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 8, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
IPR000953  Chromo/chromo_shadow_dom  
IPR040684  HMUDK_hel  
Pfam View protein in Pfam  
PF18723  aGPT-Pplase1  
PROSITE View protein in PROSITE  
PS50013  CHROMO_2  
Amino Acid Sequences MRDAKRDVFEQARRHNTPASSSCSPSSRQPRSRGSFIRQPPPKKVSIAGKEFRVSPVLDTFFWFVTERHRVHQRRLAGERQPWTTDEILSTYPFANVFRVYDRTTQYILRHVIMEGSQELNEMCFRVILFRTFCRIETWELLKRRLGNITWKSFNLKVYEEIVLSETAAVYGPAYIMPAPKLGATANAANHLRLIELMMKEKVPSRLKQFVYLRDAHGYLRLFPSMGDFIALQLLLDLNMTPHFRWDENTWAALGPGALMCIKKIFGPDIRGREYEAFKYLHESQDYHFLRLRISPRQRPRLSDTIPAGLTMVDMEHALCETEKYSRARHPNISGKKIKVARREYVPRSPPPTAILPQHWLAPGGIRRPTLRCPPPVNPHTDDPNPEYEVSHIVAEKPHYTEGPKHYLVRWAGYGPNDDIWLRECDLIEGASDALSKWQTMKARISERVAEYQATGDCEASSRTSSMKQGNNRTTSKKQSNIVIDLCGSDTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.65
3 0.57
4 0.58
5 0.54
6 0.52
7 0.47
8 0.47
9 0.47
10 0.44
11 0.45
12 0.46
13 0.52
14 0.54
15 0.58
16 0.64
17 0.71
18 0.75
19 0.82
20 0.8
21 0.77
22 0.76
23 0.76
24 0.78
25 0.77
26 0.76
27 0.76
28 0.74
29 0.7
30 0.63
31 0.62
32 0.62
33 0.62
34 0.65
35 0.6
36 0.59
37 0.57
38 0.55
39 0.5
40 0.42
41 0.33
42 0.27
43 0.28
44 0.26
45 0.24
46 0.25
47 0.25
48 0.22
49 0.23
50 0.22
51 0.16
52 0.21
53 0.3
54 0.29
55 0.34
56 0.44
57 0.47
58 0.54
59 0.61
60 0.61
61 0.61
62 0.65
63 0.66
64 0.64
65 0.66
66 0.64
67 0.6
68 0.55
69 0.47
70 0.45
71 0.38
72 0.31
73 0.25
74 0.21
75 0.19
76 0.17
77 0.18
78 0.14
79 0.13
80 0.13
81 0.13
82 0.12
83 0.12
84 0.13
85 0.15
86 0.18
87 0.21
88 0.26
89 0.28
90 0.29
91 0.31
92 0.33
93 0.31
94 0.35
95 0.34
96 0.3
97 0.27
98 0.24
99 0.23
100 0.19
101 0.19
102 0.14
103 0.13
104 0.11
105 0.11
106 0.11
107 0.1
108 0.1
109 0.09
110 0.08
111 0.07
112 0.07
113 0.1
114 0.11
115 0.14
116 0.17
117 0.18
118 0.23
119 0.24
120 0.24
121 0.24
122 0.25
123 0.25
124 0.28
125 0.32
126 0.35
127 0.37
128 0.39
129 0.39
130 0.39
131 0.37
132 0.36
133 0.32
134 0.35
135 0.39
136 0.43
137 0.43
138 0.42
139 0.44
140 0.41
141 0.42
142 0.35
143 0.29
144 0.25
145 0.24
146 0.24
147 0.2
148 0.18
149 0.16
150 0.13
151 0.12
152 0.09
153 0.07
154 0.05
155 0.05
156 0.05
157 0.03
158 0.03
159 0.04
160 0.03
161 0.04
162 0.05
163 0.05
164 0.06
165 0.07
166 0.07
167 0.07
168 0.08
169 0.07
170 0.08
171 0.09
172 0.11
173 0.11
174 0.16
175 0.16
176 0.15
177 0.15
178 0.14
179 0.12
180 0.09
181 0.1
182 0.09
183 0.1
184 0.12
185 0.13
186 0.13
187 0.14
188 0.17
189 0.23
190 0.24
191 0.26
192 0.31
193 0.38
194 0.39
195 0.47
196 0.47
197 0.46
198 0.47
199 0.45
200 0.4
201 0.34
202 0.34
203 0.26
204 0.26
205 0.2
206 0.16
207 0.16
208 0.14
209 0.12
210 0.11
211 0.13
212 0.09
213 0.09
214 0.08
215 0.06
216 0.06
217 0.07
218 0.07
219 0.04
220 0.04
221 0.04
222 0.03
223 0.03
224 0.03
225 0.03
226 0.05
227 0.06
228 0.06
229 0.07
230 0.09
231 0.09
232 0.11
233 0.13
234 0.17
235 0.18
236 0.18
237 0.17
238 0.15
239 0.15
240 0.13
241 0.11
242 0.05
243 0.04
244 0.04
245 0.04
246 0.04
247 0.04
248 0.05
249 0.05
250 0.06
251 0.07
252 0.09
253 0.1
254 0.16
255 0.21
256 0.26
257 0.29
258 0.28
259 0.3
260 0.31
261 0.31
262 0.26
263 0.25
264 0.2
265 0.17
266 0.22
267 0.22
268 0.21
269 0.2
270 0.2
271 0.17
272 0.27
273 0.28
274 0.25
275 0.26
276 0.23
277 0.23
278 0.27
279 0.3
280 0.29
281 0.36
282 0.44
283 0.5
284 0.61
285 0.62
286 0.63
287 0.66
288 0.65
289 0.6
290 0.57
291 0.5
292 0.43
293 0.41
294 0.36
295 0.29
296 0.2
297 0.16
298 0.1
299 0.07
300 0.04
301 0.04
302 0.04
303 0.03
304 0.04
305 0.04
306 0.04
307 0.04
308 0.05
309 0.07
310 0.12
311 0.15
312 0.19
313 0.26
314 0.34
315 0.39
316 0.44
317 0.5
318 0.55
319 0.61
320 0.66
321 0.65
322 0.59
323 0.61
324 0.63
325 0.61
326 0.6
327 0.59
328 0.55
329 0.58
330 0.65
331 0.63
332 0.66
333 0.67
334 0.64
335 0.64
336 0.6
337 0.52
338 0.47
339 0.45
340 0.39
341 0.37
342 0.33
343 0.3
344 0.29
345 0.3
346 0.27
347 0.23
348 0.19
349 0.2
350 0.21
351 0.22
352 0.24
353 0.24
354 0.26
355 0.29
356 0.35
357 0.4
358 0.43
359 0.46
360 0.49
361 0.56
362 0.63
363 0.65
364 0.66
365 0.6
366 0.59
367 0.58
368 0.54
369 0.51
370 0.44
371 0.43
372 0.38
373 0.34
374 0.3
375 0.24
376 0.23
377 0.2
378 0.18
379 0.14
380 0.13
381 0.15
382 0.17
383 0.18
384 0.18
385 0.18
386 0.18
387 0.21
388 0.27
389 0.31
390 0.37
391 0.38
392 0.38
393 0.38
394 0.44
395 0.43
396 0.39
397 0.34
398 0.28
399 0.28
400 0.28
401 0.3
402 0.24
403 0.24
404 0.22
405 0.2
406 0.19
407 0.18
408 0.19
409 0.18
410 0.18
411 0.17
412 0.16
413 0.17
414 0.16
415 0.13
416 0.11
417 0.09
418 0.08
419 0.08
420 0.07
421 0.09
422 0.1
423 0.1
424 0.11
425 0.17
426 0.21
427 0.27
428 0.34
429 0.39
430 0.46
431 0.51
432 0.54
433 0.55
434 0.54
435 0.55
436 0.5
437 0.42
438 0.36
439 0.33
440 0.3
441 0.26
442 0.23
443 0.17
444 0.15
445 0.15
446 0.16
447 0.16
448 0.16
449 0.14
450 0.16
451 0.19
452 0.26
453 0.33
454 0.39
455 0.46
456 0.54
457 0.62
458 0.68
459 0.71
460 0.72
461 0.73
462 0.76
463 0.76
464 0.73
465 0.69
466 0.7
467 0.71
468 0.69
469 0.62
470 0.54
471 0.46
472 0.39