Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2RN85

Protein Details
Accession M2RN85   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
246-265VDRRGPPRRDSPPPPPRRDWBasic
268-293RDRGGRRPVSRSRSRSPPRRRAGRFDBasic
NLS Segment(s)
PositionSequence
211-291RGGGHWRGGSDPAPPGPRGRGRGGDFAGRDRDFDRVDRRGPPRRDSPPPPPRRDWGDRDRGGRRPVSRSRSRSPPRRRAGR
Subcellular Location(s) nucl 10, cyto 7, extr 7, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR010516  SAP18  
IPR042534  SAP18_sf  
Pfam View protein in Pfam  
PF06487  SAP18  
Amino Acid Sequences MEETTPAGRPIVDREKTAPFLIRTFIKIGSFHRLTQFDDGSVPIADEQQIFTWKDATLREVLTTLRATAPASPEYRHPLARYSFRALYADSAARGRVAQKDLGLVYSRDILGEPGSLASPAPRLLSDADAPPPADERTLDELRFVPGDYLCVAVLLPKNATVPGPAGELAIKGSGTAPPAPAAANGWKSLGARDAGWGGAAATTPGPPAGRGGGHWRGGSDPAPPGPRGRGRGGDFAGRDRDFDRVDRRGPPRRDSPPPPPRRDWGDRDRGGRRPVSRSRSRSPPRRRAGRFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.41
3 0.44
4 0.45
5 0.42
6 0.34
7 0.34
8 0.35
9 0.34
10 0.3
11 0.3
12 0.29
13 0.26
14 0.26
15 0.28
16 0.33
17 0.33
18 0.32
19 0.37
20 0.36
21 0.37
22 0.4
23 0.38
24 0.29
25 0.27
26 0.25
27 0.2
28 0.18
29 0.16
30 0.1
31 0.1
32 0.1
33 0.1
34 0.1
35 0.1
36 0.15
37 0.15
38 0.16
39 0.16
40 0.16
41 0.18
42 0.18
43 0.19
44 0.17
45 0.17
46 0.17
47 0.16
48 0.16
49 0.16
50 0.16
51 0.14
52 0.12
53 0.12
54 0.12
55 0.13
56 0.16
57 0.17
58 0.19
59 0.18
60 0.21
61 0.27
62 0.29
63 0.3
64 0.28
65 0.29
66 0.33
67 0.38
68 0.4
69 0.39
70 0.38
71 0.37
72 0.37
73 0.31
74 0.28
75 0.24
76 0.21
77 0.15
78 0.14
79 0.13
80 0.12
81 0.12
82 0.12
83 0.14
84 0.15
85 0.15
86 0.15
87 0.17
88 0.17
89 0.17
90 0.17
91 0.13
92 0.11
93 0.12
94 0.11
95 0.09
96 0.09
97 0.08
98 0.07
99 0.07
100 0.06
101 0.05
102 0.05
103 0.05
104 0.05
105 0.05
106 0.05
107 0.06
108 0.06
109 0.06
110 0.07
111 0.08
112 0.1
113 0.11
114 0.11
115 0.12
116 0.12
117 0.12
118 0.11
119 0.12
120 0.1
121 0.09
122 0.08
123 0.11
124 0.16
125 0.18
126 0.18
127 0.17
128 0.18
129 0.18
130 0.18
131 0.14
132 0.08
133 0.07
134 0.07
135 0.07
136 0.07
137 0.06
138 0.06
139 0.05
140 0.07
141 0.08
142 0.08
143 0.07
144 0.07
145 0.08
146 0.08
147 0.08
148 0.07
149 0.07
150 0.07
151 0.08
152 0.07
153 0.07
154 0.07
155 0.07
156 0.07
157 0.06
158 0.05
159 0.04
160 0.05
161 0.05
162 0.07
163 0.07
164 0.07
165 0.08
166 0.08
167 0.08
168 0.08
169 0.09
170 0.11
171 0.12
172 0.12
173 0.12
174 0.13
175 0.13
176 0.13
177 0.13
178 0.11
179 0.09
180 0.1
181 0.1
182 0.09
183 0.09
184 0.08
185 0.06
186 0.05
187 0.05
188 0.05
189 0.04
190 0.05
191 0.05
192 0.06
193 0.06
194 0.06
195 0.07
196 0.08
197 0.08
198 0.09
199 0.16
200 0.21
201 0.24
202 0.23
203 0.23
204 0.23
205 0.25
206 0.24
207 0.19
208 0.17
209 0.18
210 0.21
211 0.21
212 0.22
213 0.27
214 0.32
215 0.34
216 0.36
217 0.39
218 0.4
219 0.46
220 0.46
221 0.45
222 0.4
223 0.4
224 0.43
225 0.35
226 0.33
227 0.28
228 0.3
229 0.26
230 0.3
231 0.33
232 0.32
233 0.36
234 0.43
235 0.51
236 0.57
237 0.61
238 0.63
239 0.65
240 0.67
241 0.73
242 0.72
243 0.75
244 0.75
245 0.8
246 0.81
247 0.77
248 0.76
249 0.76
250 0.76
251 0.74
252 0.73
253 0.73
254 0.71
255 0.74
256 0.74
257 0.72
258 0.7
259 0.69
260 0.64
261 0.62
262 0.66
263 0.68
264 0.71
265 0.72
266 0.73
267 0.77
268 0.82
269 0.83
270 0.85
271 0.86
272 0.86
273 0.89