Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2QVF9

Protein Details
Accession M2QVF9    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAKSKNHTNHNQNKKAHRNGIKKPTSHydrophilic
NLS Segment(s)
PositionSequence
14-41KKAHRNGIKKPTSHRARSMKGVDLKFRR
Subcellular Location(s) nucl 23, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNKKAHRNGIKKPTSHRARSMKGVDLKFRRNARYALAGSRQARAEQKASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.82
4 0.81
5 0.79
6 0.8
7 0.83
8 0.79
9 0.72
10 0.7
11 0.71
12 0.69
13 0.64
14 0.63
15 0.6
16 0.57
17 0.6
18 0.57
19 0.52
20 0.51
21 0.49
22 0.48
23 0.46
24 0.47
25 0.48
26 0.5
27 0.48
28 0.44
29 0.43
30 0.39
31 0.41
32 0.39
33 0.37
34 0.37
35 0.41
36 0.4
37 0.42
38 0.39
39 0.36
40 0.38
41 0.37