Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2R4S9

Protein Details
Accession M2R4S9   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
12-37DSEEKAEDWRRGRRRRASREAYEFIKBasic
NLS Segment(s)
PositionSequence
21-28RRGRRRRA
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, cyto 5.5, mito 3, pero 3
Family & Domain DBs
Amino Acid Sequences MPKDQSRAATQDSEEKAEDWRRGRRRRASREAYEFIKQEYRQNTELDINDVLNKVKRIYGPDAAYMTRKSVWNMLDKMRKREHCLSPSERRARIQELLQNNPDPSFKTVRSWTTSLGATQATVFREVAKLQDEMDTQDTPVAGADHGSGLRLYDSISRDVTYPLPEPPLVGTHIDKLLRAADDRQQRDLTLGVSGQDGIDIATDALGAEGGGVGAHLLGHQHDTHPIVHSQQPSSPRNVWGAANNEYLPLSGENMSAYACWPSPEAKYQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.31
3 0.34
4 0.36
5 0.4
6 0.38
7 0.46
8 0.52
9 0.61
10 0.71
11 0.75
12 0.8
13 0.84
14 0.89
15 0.88
16 0.88
17 0.87
18 0.82
19 0.76
20 0.71
21 0.61
22 0.54
23 0.51
24 0.43
25 0.41
26 0.42
27 0.43
28 0.39
29 0.39
30 0.39
31 0.36
32 0.36
33 0.32
34 0.27
35 0.22
36 0.22
37 0.22
38 0.21
39 0.18
40 0.19
41 0.16
42 0.18
43 0.2
44 0.24
45 0.28
46 0.33
47 0.32
48 0.34
49 0.35
50 0.33
51 0.34
52 0.29
53 0.26
54 0.22
55 0.21
56 0.19
57 0.22
58 0.23
59 0.28
60 0.31
61 0.36
62 0.43
63 0.46
64 0.52
65 0.56
66 0.57
67 0.57
68 0.63
69 0.64
70 0.6
71 0.64
72 0.64
73 0.65
74 0.71
75 0.71
76 0.64
77 0.58
78 0.56
79 0.53
80 0.48
81 0.42
82 0.39
83 0.37
84 0.39
85 0.39
86 0.37
87 0.33
88 0.31
89 0.27
90 0.23
91 0.21
92 0.2
93 0.18
94 0.2
95 0.24
96 0.26
97 0.3
98 0.3
99 0.28
100 0.26
101 0.25
102 0.21
103 0.19
104 0.15
105 0.11
106 0.1
107 0.11
108 0.09
109 0.1
110 0.09
111 0.08
112 0.09
113 0.09
114 0.1
115 0.1
116 0.09
117 0.09
118 0.11
119 0.1
120 0.11
121 0.13
122 0.12
123 0.1
124 0.1
125 0.1
126 0.08
127 0.08
128 0.06
129 0.04
130 0.04
131 0.04
132 0.04
133 0.04
134 0.05
135 0.04
136 0.04
137 0.05
138 0.04
139 0.05
140 0.08
141 0.1
142 0.12
143 0.12
144 0.13
145 0.13
146 0.15
147 0.15
148 0.14
149 0.13
150 0.12
151 0.14
152 0.13
153 0.13
154 0.12
155 0.13
156 0.12
157 0.13
158 0.12
159 0.12
160 0.15
161 0.15
162 0.14
163 0.14
164 0.14
165 0.13
166 0.14
167 0.14
168 0.17
169 0.26
170 0.28
171 0.31
172 0.3
173 0.29
174 0.29
175 0.28
176 0.22
177 0.15
178 0.13
179 0.09
180 0.09
181 0.09
182 0.07
183 0.06
184 0.06
185 0.04
186 0.04
187 0.04
188 0.04
189 0.03
190 0.03
191 0.03
192 0.03
193 0.03
194 0.03
195 0.02
196 0.02
197 0.02
198 0.02
199 0.02
200 0.02
201 0.02
202 0.02
203 0.02
204 0.03
205 0.04
206 0.06
207 0.07
208 0.08
209 0.11
210 0.13
211 0.15
212 0.17
213 0.18
214 0.19
215 0.24
216 0.27
217 0.26
218 0.29
219 0.36
220 0.36
221 0.42
222 0.41
223 0.39
224 0.38
225 0.39
226 0.37
227 0.34
228 0.36
229 0.34
230 0.34
231 0.31
232 0.29
233 0.26
234 0.24
235 0.2
236 0.16
237 0.14
238 0.12
239 0.12
240 0.11
241 0.12
242 0.12
243 0.1
244 0.1
245 0.1
246 0.1
247 0.11
248 0.12
249 0.15