Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2R0G1

Protein Details
Accession M2R0G1    Localization Confidence Low Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
41-60TALIKWKYNKWRNEREQRLTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 8.5, cyto_mito 8.5, cyto 7.5, extr 5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR024242  NCE101  
Gene Ontology GO:0009306  P:protein secretion  
Pfam View protein in Pfam  
PF11654  NCE101  
Amino Acid Sequences MPPVLLSRRLDPLLGVFTGVFAYYLYESHPRNAVPPEERLTALIKWKYNKWRNEREQRLTAGNDDEIDLKALAVEVEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.17
3 0.11
4 0.11
5 0.11
6 0.1
7 0.08
8 0.05
9 0.06
10 0.05
11 0.06
12 0.08
13 0.12
14 0.13
15 0.14
16 0.16
17 0.15
18 0.17
19 0.19
20 0.21
21 0.19
22 0.21
23 0.23
24 0.23
25 0.23
26 0.21
27 0.21
28 0.18
29 0.22
30 0.22
31 0.22
32 0.23
33 0.29
34 0.38
35 0.44
36 0.52
37 0.55
38 0.63
39 0.7
40 0.79
41 0.83
42 0.8
43 0.77
44 0.72
45 0.67
46 0.58
47 0.5
48 0.41
49 0.32
50 0.25
51 0.21
52 0.19
53 0.15
54 0.15
55 0.12
56 0.09
57 0.09
58 0.08