Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0DZ27

Protein Details
Accession B0DZ27    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
157-180FWSKPRGARRLMRRSKNTRKSMSTHydrophilic
NLS Segment(s)
PositionSequence
161-174PRGARRLMRRSKNT
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
KEGG lbc:LACBIDRAFT_334393  -  
Amino Acid Sequences MDLPSTYSEAQPPYFNHSSHSSKEKVPSLILGGTYSSKKSATAILGYTMNEQTRIAGAVPESFSTTAAVPKRSSDTRKINRLIRYMDEPTRRALLEQDEWASDVKPNSVVCNGCKKTFVLDSRFRYYPAFWWKHRDRYCKVIRRLRGESTSVPIQEFWSKPRGARRLMRRSKNTRKSMSTSSVASAAKSQELEGPTRSSHQEPTVRAPLKSSEIYDAWKSSLRSACQKQYLQLAIEHKLERAHVPFASMASGIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.33
3 0.33
4 0.37
5 0.4
6 0.41
7 0.46
8 0.41
9 0.41
10 0.48
11 0.5
12 0.45
13 0.41
14 0.38
15 0.34
16 0.32
17 0.28
18 0.22
19 0.17
20 0.18
21 0.18
22 0.18
23 0.16
24 0.15
25 0.15
26 0.15
27 0.18
28 0.18
29 0.19
30 0.18
31 0.19
32 0.21
33 0.21
34 0.22
35 0.21
36 0.18
37 0.17
38 0.16
39 0.13
40 0.13
41 0.13
42 0.1
43 0.09
44 0.09
45 0.1
46 0.11
47 0.11
48 0.12
49 0.11
50 0.12
51 0.12
52 0.12
53 0.15
54 0.17
55 0.19
56 0.18
57 0.19
58 0.24
59 0.29
60 0.34
61 0.38
62 0.46
63 0.52
64 0.6
65 0.65
66 0.66
67 0.66
68 0.66
69 0.6
70 0.52
71 0.49
72 0.45
73 0.45
74 0.44
75 0.39
76 0.36
77 0.35
78 0.31
79 0.26
80 0.23
81 0.21
82 0.18
83 0.19
84 0.18
85 0.16
86 0.16
87 0.16
88 0.14
89 0.12
90 0.1
91 0.09
92 0.1
93 0.1
94 0.11
95 0.14
96 0.14
97 0.15
98 0.25
99 0.26
100 0.25
101 0.26
102 0.24
103 0.24
104 0.28
105 0.31
106 0.27
107 0.33
108 0.38
109 0.41
110 0.42
111 0.4
112 0.35
113 0.31
114 0.31
115 0.33
116 0.33
117 0.3
118 0.38
119 0.42
120 0.51
121 0.57
122 0.58
123 0.52
124 0.57
125 0.65
126 0.66
127 0.7
128 0.68
129 0.68
130 0.67
131 0.68
132 0.63
133 0.56
134 0.5
135 0.42
136 0.39
137 0.35
138 0.28
139 0.24
140 0.2
141 0.19
142 0.2
143 0.2
144 0.18
145 0.2
146 0.2
147 0.23
148 0.31
149 0.34
150 0.37
151 0.44
152 0.52
153 0.58
154 0.67
155 0.74
156 0.75
157 0.8
158 0.85
159 0.88
160 0.86
161 0.82
162 0.78
163 0.74
164 0.71
165 0.66
166 0.57
167 0.49
168 0.41
169 0.39
170 0.33
171 0.27
172 0.23
173 0.18
174 0.17
175 0.16
176 0.15
177 0.14
178 0.16
179 0.17
180 0.17
181 0.19
182 0.18
183 0.21
184 0.23
185 0.22
186 0.23
187 0.28
188 0.32
189 0.33
190 0.39
191 0.46
192 0.46
193 0.44
194 0.42
195 0.39
196 0.38
197 0.37
198 0.31
199 0.26
200 0.25
201 0.29
202 0.3
203 0.27
204 0.24
205 0.27
206 0.26
207 0.28
208 0.32
209 0.33
210 0.4
211 0.46
212 0.52
213 0.56
214 0.57
215 0.54
216 0.56
217 0.55
218 0.47
219 0.45
220 0.41
221 0.37
222 0.4
223 0.37
224 0.31
225 0.29
226 0.29
227 0.28
228 0.27
229 0.27
230 0.22
231 0.24
232 0.23
233 0.22
234 0.22