Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2QXN3

Protein Details
Accession M2QXN3   
Localization Confidence High
Confidence Score 22.4
NoLS Segment(s)
PositionSequenceProtein Nature
13-41LALAGETEKKRKKQRQAQSKSSAVKRRKAHydrophilic
143-168LDELKARRKAKDEKKRTRDMSPKREABasic
NLS Segment(s)
PositionSequence
21-40KKRKKQRQAQSKSSAVKRRK
124-165KAAKRQHTVRGATKEKTRKLDELKARRKAKDEKKRTRDMSPK
442-451ERKRRERKLL
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004343  Plus-3_dom  
IPR036128  Plus3-like_sf  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF03126  Plus-3  
PROSITE View protein in PROSITE  
PS51360  PLUS3  
Amino Acid Sequences MSDTEGDIDDELLALAGETEKKRKKQRQAQSKSSAVKRRKADVSDSDSEQPESEEDDVANPYPLEGKYVDEEDRNRLMQMPEIEREGIIEQRLEEMQRIQDQRNLDQMLKAQSGGRGAEESVAKAAKRQHTVRGATKEKTRKLDELKARRKAKDEKKRTRDMSPKREASSSPVDMDMSDDEEEDGQITKYDEQEEKERRILDKVNSRDDSPSMLEDFENVRLSRELLVKHSAAPWFSEYCKGAWVRYLIGNDRENRPLYRMCEIVEVSQTGAKSYEINGRVFNQEIELKYGGAVKRFPMDKASNGPFTTTEYEHLLKTLTNDRAAVPTKRQLETKRAQIVDLPNRPMTESDVSAMLARKRNMQGKQSAASMTMERSRLSQARTLALRRQDYDEVKQIDAQLAELTPARSDREDKADILAKVNERNRKANMEAVRRAEILEAERKRRERKLLAAGGRGTVTPGTPEPGARLKPGLKVSNSRPGTPGTPALQTDAGTPRSVSPLPSSLLPASTLSKPSNLNESSNFEQAVLESVELDLGDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.06
4 0.11
5 0.14
6 0.24
7 0.32
8 0.41
9 0.52
10 0.62
11 0.72
12 0.77
13 0.86
14 0.87
15 0.9
16 0.92
17 0.9
18 0.89
19 0.86
20 0.85
21 0.84
22 0.81
23 0.78
24 0.74
25 0.73
26 0.72
27 0.68
28 0.66
29 0.66
30 0.66
31 0.63
32 0.61
33 0.57
34 0.51
35 0.47
36 0.39
37 0.31
38 0.23
39 0.21
40 0.18
41 0.14
42 0.13
43 0.14
44 0.15
45 0.15
46 0.16
47 0.12
48 0.11
49 0.14
50 0.14
51 0.15
52 0.14
53 0.15
54 0.17
55 0.21
56 0.23
57 0.24
58 0.26
59 0.3
60 0.33
61 0.31
62 0.29
63 0.29
64 0.28
65 0.28
66 0.32
67 0.31
68 0.29
69 0.3
70 0.3
71 0.26
72 0.27
73 0.23
74 0.19
75 0.15
76 0.14
77 0.12
78 0.14
79 0.15
80 0.15
81 0.15
82 0.15
83 0.17
84 0.24
85 0.28
86 0.27
87 0.3
88 0.32
89 0.34
90 0.38
91 0.37
92 0.31
93 0.29
94 0.31
95 0.32
96 0.3
97 0.28
98 0.22
99 0.21
100 0.22
101 0.21
102 0.17
103 0.13
104 0.13
105 0.15
106 0.15
107 0.14
108 0.14
109 0.15
110 0.14
111 0.17
112 0.23
113 0.26
114 0.33
115 0.35
116 0.41
117 0.48
118 0.54
119 0.59
120 0.61
121 0.61
122 0.58
123 0.64
124 0.65
125 0.63
126 0.64
127 0.6
128 0.59
129 0.6
130 0.65
131 0.67
132 0.69
133 0.72
134 0.75
135 0.77
136 0.73
137 0.73
138 0.74
139 0.75
140 0.75
141 0.76
142 0.78
143 0.8
144 0.87
145 0.83
146 0.82
147 0.82
148 0.81
149 0.81
150 0.79
151 0.76
152 0.68
153 0.66
154 0.57
155 0.53
156 0.5
157 0.41
158 0.32
159 0.27
160 0.25
161 0.22
162 0.23
163 0.17
164 0.12
165 0.1
166 0.09
167 0.08
168 0.08
169 0.08
170 0.07
171 0.07
172 0.05
173 0.06
174 0.07
175 0.08
176 0.09
177 0.12
178 0.13
179 0.15
180 0.24
181 0.29
182 0.31
183 0.33
184 0.35
185 0.33
186 0.35
187 0.37
188 0.35
189 0.39
190 0.4
191 0.45
192 0.44
193 0.44
194 0.42
195 0.37
196 0.33
197 0.25
198 0.22
199 0.14
200 0.14
201 0.12
202 0.12
203 0.13
204 0.12
205 0.14
206 0.12
207 0.13
208 0.13
209 0.14
210 0.15
211 0.17
212 0.16
213 0.16
214 0.19
215 0.18
216 0.19
217 0.2
218 0.18
219 0.16
220 0.16
221 0.15
222 0.14
223 0.14
224 0.17
225 0.15
226 0.14
227 0.17
228 0.17
229 0.15
230 0.16
231 0.16
232 0.14
233 0.16
234 0.18
235 0.16
236 0.2
237 0.24
238 0.24
239 0.26
240 0.27
241 0.26
242 0.25
243 0.25
244 0.24
245 0.23
246 0.23
247 0.21
248 0.18
249 0.19
250 0.19
251 0.17
252 0.15
253 0.12
254 0.1
255 0.11
256 0.1
257 0.08
258 0.08
259 0.07
260 0.07
261 0.08
262 0.14
263 0.15
264 0.16
265 0.17
266 0.18
267 0.19
268 0.19
269 0.17
270 0.13
271 0.13
272 0.12
273 0.15
274 0.13
275 0.12
276 0.12
277 0.16
278 0.15
279 0.14
280 0.14
281 0.11
282 0.15
283 0.16
284 0.16
285 0.19
286 0.2
287 0.21
288 0.26
289 0.29
290 0.28
291 0.27
292 0.28
293 0.22
294 0.23
295 0.24
296 0.18
297 0.16
298 0.16
299 0.18
300 0.17
301 0.17
302 0.14
303 0.11
304 0.13
305 0.19
306 0.17
307 0.17
308 0.18
309 0.18
310 0.22
311 0.25
312 0.25
313 0.21
314 0.26
315 0.3
316 0.31
317 0.35
318 0.34
319 0.4
320 0.43
321 0.48
322 0.49
323 0.45
324 0.43
325 0.43
326 0.47
327 0.47
328 0.47
329 0.42
330 0.36
331 0.36
332 0.36
333 0.32
334 0.28
335 0.21
336 0.17
337 0.14
338 0.14
339 0.14
340 0.15
341 0.17
342 0.17
343 0.19
344 0.19
345 0.24
346 0.29
347 0.36
348 0.39
349 0.43
350 0.45
351 0.44
352 0.46
353 0.42
354 0.37
355 0.31
356 0.28
357 0.23
358 0.19
359 0.18
360 0.17
361 0.15
362 0.16
363 0.2
364 0.22
365 0.23
366 0.25
367 0.24
368 0.28
369 0.31
370 0.34
371 0.34
372 0.38
373 0.39
374 0.36
375 0.39
376 0.4
377 0.4
378 0.42
379 0.44
380 0.4
381 0.37
382 0.37
383 0.32
384 0.28
385 0.24
386 0.2
387 0.13
388 0.1
389 0.11
390 0.1
391 0.1
392 0.09
393 0.1
394 0.11
395 0.13
396 0.16
397 0.18
398 0.24
399 0.26
400 0.26
401 0.29
402 0.33
403 0.32
404 0.32
405 0.32
406 0.28
407 0.33
408 0.38
409 0.42
410 0.4
411 0.45
412 0.46
413 0.47
414 0.47
415 0.48
416 0.5
417 0.51
418 0.53
419 0.51
420 0.5
421 0.45
422 0.43
423 0.36
424 0.3
425 0.25
426 0.28
427 0.3
428 0.34
429 0.41
430 0.47
431 0.53
432 0.59
433 0.64
434 0.62
435 0.65
436 0.69
437 0.71
438 0.7
439 0.69
440 0.62
441 0.55
442 0.48
443 0.39
444 0.3
445 0.21
446 0.16
447 0.12
448 0.12
449 0.14
450 0.14
451 0.14
452 0.17
453 0.23
454 0.25
455 0.24
456 0.29
457 0.29
458 0.34
459 0.41
460 0.44
461 0.42
462 0.48
463 0.51
464 0.56
465 0.56
466 0.52
467 0.46
468 0.44
469 0.41
470 0.38
471 0.37
472 0.3
473 0.31
474 0.3
475 0.31
476 0.29
477 0.26
478 0.27
479 0.27
480 0.26
481 0.23
482 0.23
483 0.21
484 0.25
485 0.26
486 0.23
487 0.22
488 0.24
489 0.25
490 0.26
491 0.28
492 0.24
493 0.24
494 0.24
495 0.21
496 0.22
497 0.23
498 0.26
499 0.24
500 0.27
501 0.29
502 0.3
503 0.37
504 0.36
505 0.36
506 0.36
507 0.42
508 0.42
509 0.42
510 0.4
511 0.31
512 0.29
513 0.25
514 0.25
515 0.18
516 0.14
517 0.11
518 0.1
519 0.11