Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2PEP0

Protein Details
Accession M2PEP0    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-49TSPRRRRHGTRPRRHRPWSRSPRPTCAYPRRTRIRRPRLRKTRACLLCABasic
NLS Segment(s)
PositionSequence
4-42RRRRHGTRPRRHRPWSRSPRPTCAYPRRTRIRRPRLRKT
Subcellular Location(s) nucl 12.5, mito 12, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences TSPRRRRHGTRPRRHRPWSRSPRPTCAYPRRTRIRRPRLRKTRACLLCARGTGAPAPAVRRHLLLPAVRSPTSDTRPPAHTRTAELAARPRPPHDVTLPSRLLSSAFSNILLFVGPPPASFVSLHELYDTPHTLARSCRTLHFCIPRASPWTLCTRTTCAPAPPILTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.94
3 0.91
4 0.92
5 0.92
6 0.91
7 0.91
8 0.87
9 0.86
10 0.81
11 0.8
12 0.79
13 0.78
14 0.77
15 0.75
16 0.79
17 0.8
18 0.83
19 0.85
20 0.86
21 0.87
22 0.87
23 0.89
24 0.9
25 0.9
26 0.93
27 0.91
28 0.87
29 0.86
30 0.81
31 0.75
32 0.69
33 0.63
34 0.57
35 0.48
36 0.43
37 0.33
38 0.28
39 0.25
40 0.2
41 0.17
42 0.14
43 0.16
44 0.15
45 0.18
46 0.17
47 0.18
48 0.17
49 0.17
50 0.2
51 0.19
52 0.2
53 0.22
54 0.25
55 0.24
56 0.24
57 0.25
58 0.26
59 0.28
60 0.29
61 0.27
62 0.27
63 0.31
64 0.35
65 0.34
66 0.33
67 0.3
68 0.29
69 0.29
70 0.29
71 0.26
72 0.23
73 0.25
74 0.24
75 0.27
76 0.26
77 0.24
78 0.25
79 0.26
80 0.28
81 0.25
82 0.29
83 0.29
84 0.35
85 0.35
86 0.31
87 0.29
88 0.26
89 0.24
90 0.18
91 0.16
92 0.11
93 0.11
94 0.11
95 0.11
96 0.1
97 0.1
98 0.08
99 0.07
100 0.05
101 0.07
102 0.07
103 0.07
104 0.09
105 0.1
106 0.11
107 0.11
108 0.13
109 0.16
110 0.17
111 0.17
112 0.16
113 0.16
114 0.15
115 0.19
116 0.19
117 0.14
118 0.15
119 0.16
120 0.16
121 0.2
122 0.24
123 0.25
124 0.25
125 0.31
126 0.34
127 0.38
128 0.45
129 0.49
130 0.5
131 0.51
132 0.52
133 0.49
134 0.49
135 0.48
136 0.41
137 0.36
138 0.41
139 0.38
140 0.38
141 0.38
142 0.39
143 0.39
144 0.42
145 0.42
146 0.37
147 0.38
148 0.38