FuNGI

M2RG65

Protein Details

Accession

M2RG65

Localization Confidence

Low

Confidence Score

8.8

NoLS Segment(s)

Position	Sequence	Protein Nature
58-79	GDVPAPVKKPRKKTTAKPADAA	Hydrophilic

NLS Segment(s)

Position	Sequence
65-72	KKPRKKTT

Subcellular Location(s)

mito 22, cyto_nucl 3, nucl 2.5, cyto 2.5

Family & Domain DBs

InterPro	View protein in InterPro IPR011257 DNA_glycosylase IPR003265 HhH-GPD_domain
Gene Ontology	GO:0003824 F:catalytic activity GO:0006285 P:base-excision repair, AP site formation
Pfam	View protein in Pfam PF00730 HhH-GPD
CDD	cd00056 ENDO3c

Amino Acid Sequences

MLRALGRRVPTNLRTIRMPVTRSASRAAAAASTPVEDQVVKTPRTNGKFSKREADDAGDVPAPVKKPRKKTTAKPADAAPPAPAQSVAKAVVPAIPLGEPAALVPAVLTFSFEDAKKHLISVDRRFKDIFDRLKCRPFEHLERVDPFRTLTDSILGQQISWRAARSIRHRFIRLFDPSLPEQLEDHQTIDFFPTAQQVASIDSATLRTAGLSGRKAEYVLDLASRFADGRLSTQKLLEADEEELYRMLTEVRGIGNWTVDMFAIFSLRRPDILPVGDLGVQRGILRWFLSLHDPSYLVNISPQKLPKPSSDEGQGDKVEQDGAADESEPAAAGPARALSPDTSSTLPAPEIPATPANKGKKKSDDESAMPPPFTPSINKTLNMYARGEVDVPPLPEGLTPGALKSRLDVKKKIKGAILTPKEMEELTQPWRPYRSLGVFYMWALAEGTK

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.49
2	0.5
3	0.53
4	0.5
5	0.49
6	0.45
7	0.47
8	0.47
9	0.46
10	0.46
11	0.39
12	0.34
13	0.32
14	0.27
15	0.2
16	0.17
17	0.17
18	0.14
19	0.13
20	0.13
21	0.12
22	0.12
23	0.11
24	0.12
25	0.19
26	0.25
27	0.25
28	0.28
29	0.35
30	0.43
31	0.48
32	0.53
33	0.54
34	0.58
35	0.64
36	0.66
37	0.68
38	0.63
39	0.62
40	0.59
41	0.55
42	0.47
43	0.41
44	0.39
45	0.3
46	0.26
47	0.22
48	0.22
49	0.19
50	0.23
51	0.32
52	0.37
53	0.46
54	0.56
55	0.66
56	0.72
57	0.8
58	0.84
59	0.85
60	0.83
61	0.75
62	0.71
63	0.69
64	0.62
65	0.53
66	0.44
67	0.35
68	0.31
69	0.28
70	0.25
71	0.17
72	0.15
73	0.17
74	0.15
75	0.14
76	0.13
77	0.13
78	0.13
79	0.13
80	0.12
81	0.1
82	0.09
83	0.08
84	0.09
85	0.08
86	0.06
87	0.05
88	0.07
89	0.06
90	0.05
91	0.05
92	0.05
93	0.06
94	0.06
95	0.07
96	0.05
97	0.07
98	0.1
99	0.1
100	0.12
101	0.13
102	0.16
103	0.15
104	0.16
105	0.17
106	0.21
107	0.28
108	0.37
109	0.46
110	0.44
111	0.47
112	0.47
113	0.45
114	0.46
115	0.47
116	0.46
117	0.44
118	0.49
119	0.51
120	0.58
121	0.59
122	0.53
123	0.52
124	0.49
125	0.49
126	0.52
127	0.53
128	0.51
129	0.53
130	0.56
131	0.5
132	0.43
133	0.36
134	0.27
135	0.24
136	0.19
137	0.16
138	0.13
139	0.12
140	0.13
141	0.15
142	0.14
143	0.12
144	0.12
145	0.13
146	0.13
147	0.13
148	0.13
149	0.11
150	0.14
151	0.2
152	0.28
153	0.37
154	0.42
155	0.47
156	0.5
157	0.5
158	0.51
159	0.52
160	0.48
161	0.41
162	0.35
163	0.35
164	0.32
165	0.33
166	0.3
167	0.23
168	0.19
169	0.18
170	0.2
171	0.15
172	0.15
173	0.12
174	0.12
175	0.12
176	0.13
177	0.1
178	0.07
179	0.07
180	0.07
181	0.08
182	0.07
183	0.07
184	0.06
185	0.08
186	0.08
187	0.08
188	0.06
189	0.06
190	0.06
191	0.06
192	0.06
193	0.05
194	0.04
195	0.05
196	0.06
197	0.09
198	0.09
199	0.11
200	0.11
201	0.12
202	0.12
203	0.12
204	0.11
205	0.09
206	0.08
207	0.08
208	0.07
209	0.07
210	0.07
211	0.07
212	0.07
213	0.05
214	0.07
215	0.06
216	0.08
217	0.13
218	0.15
219	0.15
220	0.15
221	0.17
222	0.16
223	0.17
224	0.14
225	0.11
226	0.1
227	0.1
228	0.1
229	0.09
230	0.09
231	0.07
232	0.07
233	0.06
234	0.05
235	0.04
236	0.04
237	0.05
238	0.05
239	0.06
240	0.06
241	0.07
242	0.07
243	0.07
244	0.06
245	0.06
246	0.05
247	0.05
248	0.04
249	0.04
250	0.05
251	0.05
252	0.07
253	0.09
254	0.1
255	0.11
256	0.11
257	0.13
258	0.14
259	0.15
260	0.14
261	0.11
262	0.13
263	0.14
264	0.14
265	0.13
266	0.1
267	0.09
268	0.09
269	0.1
270	0.09
271	0.07
272	0.08
273	0.08
274	0.08
275	0.1
276	0.14
277	0.14
278	0.14
279	0.15
280	0.14
281	0.14
282	0.16
283	0.15
284	0.1
285	0.13
286	0.16
287	0.16
288	0.2
289	0.23
290	0.24
291	0.28
292	0.3
293	0.31
294	0.35
295	0.35
296	0.35
297	0.38
298	0.38
299	0.36
300	0.38
301	0.34
302	0.27
303	0.25
304	0.22
305	0.16
306	0.13
307	0.1
308	0.07
309	0.07
310	0.07
311	0.07
312	0.07
313	0.06
314	0.06
315	0.06
316	0.05
317	0.05
318	0.05
319	0.04
320	0.05
321	0.06
322	0.06
323	0.06
324	0.08
325	0.08
326	0.1
327	0.12
328	0.14
329	0.14
330	0.16
331	0.16
332	0.16
333	0.16
334	0.14
335	0.14
336	0.13
337	0.13
338	0.15
339	0.19
340	0.2
341	0.24
342	0.3
343	0.37
344	0.42
345	0.46
346	0.5
347	0.54
348	0.6
349	0.61
350	0.62
351	0.6
352	0.57
353	0.6
354	0.62
355	0.54
356	0.48
357	0.43
358	0.37
359	0.32
360	0.29
361	0.26
362	0.22
363	0.28
364	0.32
365	0.33
366	0.32
367	0.38
368	0.41
369	0.4
370	0.37
371	0.3
372	0.28
373	0.29
374	0.27
375	0.21
376	0.2
377	0.21
378	0.2
379	0.19
380	0.17
381	0.16
382	0.15
383	0.16
384	0.14
385	0.14
386	0.13
387	0.13
388	0.17
389	0.18
390	0.18
391	0.18
392	0.27
393	0.32
394	0.38
395	0.47
396	0.52
397	0.6
398	0.66
399	0.68
400	0.64
401	0.61
402	0.63
403	0.64
404	0.62
405	0.58
406	0.53
407	0.49
408	0.45
409	0.4
410	0.33
411	0.26
412	0.23
413	0.23
414	0.28
415	0.29
416	0.32
417	0.35
418	0.35
419	0.34
420	0.4
421	0.41
422	0.41
423	0.41
424	0.41
425	0.39
426	0.38
427	0.38
428	0.28
429	0.22

M2RG65

3D AlphaFold-predicted Structure Viewer