Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2QW63

Protein Details
Accession M2QW63    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
407-429ASTPTPWDTRRRDHPHCRASWTNHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 10, nucl 9.5, cyto_nucl 6, mito 4, cyto 1.5
Family & Domain DBs
Amino Acid Sequences MQGGPSQAQHPGRTRPLPLPKYWHHPAAQRAGRRGHPQPPARMYRIAEHLHLQPAYPRALQGRDTQVTTGKSTSMTRFPPRTTPPLRQLHSTDNEKKHVTQMRGLLQGLLPPSLLGKQRCEYSLTDAKHPSPRSACINRNNHSRVLITFLQAVAILAPLTPSAIGRTSFLRHSSKYSSSMYKTLPPSGTTKGIDCNTIATTSRSSTRSPSAKDYAVPETGSIIQFRLDSRACPSSLEQHHLVEDGPGPVSTMVEASPRDTHVHEPSGMGTLCGGRTLPIFTLLCCYDVMALYLEADSMFDNDLLSCTSPVSVRPVDGSSLEGIIQAVDALVKHMRLLRSQTYARHALHAYNRPFTPNYAHVLRPPGRARMKKPVAEASSELFFVMLCQTPPLHGQLLDLSRRYTQNASTPTPWDTRRRDHPHCRASWTNHDNPNIIGGCPYAEGGLTLGRYLGGAGEFAKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.57
3 0.64
4 0.64
5 0.64
6 0.64
7 0.62
8 0.66
9 0.67
10 0.65
11 0.58
12 0.59
13 0.61
14 0.63
15 0.64
16 0.62
17 0.63
18 0.62
19 0.64
20 0.65
21 0.64
22 0.62
23 0.64
24 0.65
25 0.68
26 0.71
27 0.72
28 0.69
29 0.68
30 0.62
31 0.58
32 0.58
33 0.51
34 0.45
35 0.4
36 0.39
37 0.39
38 0.37
39 0.31
40 0.28
41 0.28
42 0.3
43 0.26
44 0.25
45 0.23
46 0.27
47 0.29
48 0.31
49 0.36
50 0.36
51 0.36
52 0.36
53 0.37
54 0.36
55 0.36
56 0.3
57 0.22
58 0.22
59 0.24
60 0.26
61 0.28
62 0.32
63 0.38
64 0.43
65 0.45
66 0.51
67 0.53
68 0.59
69 0.59
70 0.61
71 0.62
72 0.66
73 0.66
74 0.63
75 0.61
76 0.59
77 0.6
78 0.61
79 0.61
80 0.57
81 0.6
82 0.57
83 0.54
84 0.54
85 0.54
86 0.48
87 0.43
88 0.44
89 0.45
90 0.46
91 0.45
92 0.37
93 0.3
94 0.29
95 0.25
96 0.18
97 0.13
98 0.09
99 0.1
100 0.12
101 0.18
102 0.17
103 0.21
104 0.23
105 0.26
106 0.27
107 0.29
108 0.27
109 0.29
110 0.35
111 0.33
112 0.36
113 0.37
114 0.4
115 0.44
116 0.44
117 0.42
118 0.37
119 0.38
120 0.42
121 0.47
122 0.51
123 0.53
124 0.61
125 0.61
126 0.67
127 0.66
128 0.59
129 0.53
130 0.47
131 0.37
132 0.35
133 0.3
134 0.21
135 0.19
136 0.17
137 0.15
138 0.14
139 0.13
140 0.07
141 0.06
142 0.05
143 0.03
144 0.04
145 0.03
146 0.04
147 0.04
148 0.04
149 0.05
150 0.06
151 0.07
152 0.08
153 0.11
154 0.13
155 0.15
156 0.19
157 0.22
158 0.21
159 0.26
160 0.3
161 0.3
162 0.32
163 0.34
164 0.34
165 0.33
166 0.36
167 0.32
168 0.34
169 0.33
170 0.33
171 0.31
172 0.27
173 0.28
174 0.27
175 0.29
176 0.24
177 0.23
178 0.23
179 0.23
180 0.22
181 0.19
182 0.18
183 0.14
184 0.15
185 0.15
186 0.11
187 0.12
188 0.12
189 0.16
190 0.16
191 0.16
192 0.18
193 0.24
194 0.28
195 0.29
196 0.33
197 0.33
198 0.32
199 0.32
200 0.33
201 0.29
202 0.25
203 0.22
204 0.17
205 0.15
206 0.15
207 0.14
208 0.11
209 0.09
210 0.08
211 0.08
212 0.09
213 0.11
214 0.1
215 0.1
216 0.13
217 0.15
218 0.15
219 0.16
220 0.16
221 0.21
222 0.22
223 0.25
224 0.23
225 0.21
226 0.21
227 0.21
228 0.2
229 0.12
230 0.11
231 0.08
232 0.07
233 0.06
234 0.07
235 0.06
236 0.06
237 0.05
238 0.05
239 0.04
240 0.06
241 0.06
242 0.08
243 0.09
244 0.1
245 0.12
246 0.13
247 0.16
248 0.17
249 0.19
250 0.18
251 0.17
252 0.16
253 0.18
254 0.17
255 0.13
256 0.1
257 0.09
258 0.08
259 0.08
260 0.08
261 0.05
262 0.06
263 0.07
264 0.07
265 0.1
266 0.1
267 0.1
268 0.13
269 0.13
270 0.14
271 0.12
272 0.12
273 0.09
274 0.09
275 0.1
276 0.07
277 0.06
278 0.06
279 0.06
280 0.06
281 0.05
282 0.05
283 0.05
284 0.04
285 0.05
286 0.05
287 0.05
288 0.05
289 0.06
290 0.06
291 0.06
292 0.06
293 0.06
294 0.07
295 0.07
296 0.08
297 0.13
298 0.13
299 0.12
300 0.14
301 0.15
302 0.15
303 0.15
304 0.16
305 0.11
306 0.11
307 0.1
308 0.09
309 0.08
310 0.06
311 0.06
312 0.04
313 0.04
314 0.03
315 0.03
316 0.05
317 0.06
318 0.06
319 0.07
320 0.11
321 0.13
322 0.15
323 0.21
324 0.23
325 0.29
326 0.32
327 0.35
328 0.37
329 0.42
330 0.4
331 0.39
332 0.36
333 0.35
334 0.4
335 0.45
336 0.43
337 0.41
338 0.41
339 0.4
340 0.4
341 0.37
342 0.35
343 0.29
344 0.31
345 0.3
346 0.31
347 0.3
348 0.38
349 0.4
350 0.42
351 0.42
352 0.45
353 0.51
354 0.57
355 0.61
356 0.63
357 0.67
358 0.64
359 0.66
360 0.66
361 0.59
362 0.55
363 0.51
364 0.43
365 0.36
366 0.31
367 0.26
368 0.17
369 0.14
370 0.11
371 0.11
372 0.09
373 0.08
374 0.1
375 0.1
376 0.11
377 0.14
378 0.16
379 0.16
380 0.14
381 0.15
382 0.2
383 0.25
384 0.28
385 0.28
386 0.27
387 0.29
388 0.3
389 0.33
390 0.3
391 0.28
392 0.32
393 0.37
394 0.41
395 0.4
396 0.41
397 0.42
398 0.45
399 0.47
400 0.48
401 0.49
402 0.52
403 0.6
404 0.67
405 0.73
406 0.78
407 0.84
408 0.84
409 0.81
410 0.81
411 0.79
412 0.77
413 0.77
414 0.75
415 0.73
416 0.7
417 0.69
418 0.62
419 0.53
420 0.53
421 0.43
422 0.35
423 0.26
424 0.2
425 0.17
426 0.16
427 0.16
428 0.09
429 0.08
430 0.08
431 0.08
432 0.1
433 0.09
434 0.09
435 0.09
436 0.08
437 0.08
438 0.08
439 0.08
440 0.06
441 0.07