Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2PLT7

Protein Details
Accession M2PLT7    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
125-144GFCMLDRKIKCKRCGRLLDAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 10, cyto 9.5, nucl 7.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR019317  Brain_I3  
Gene Ontology GO:0016020  C:membrane  
GO:0048471  C:perinuclear region of cytoplasm  
Pfam View protein in Pfam  
PF10164  BRI3  
Amino Acid Sequences MIVDTESAAHFSLGSEDTRTMTSAKQPMEDEPPSYEQIVHVDSTMSAAHRPHISGSDRSVPLPPPTPPRKVYSYMNPKTGEQIVSYLPPYHPEMVCVQKGEHVEQTKYGCAGLTLAFLFFPLGIGFCMLDRKIKCKRCGRLLDAGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.12
4 0.13
5 0.14
6 0.15
7 0.14
8 0.14
9 0.2
10 0.24
11 0.24
12 0.26
13 0.27
14 0.29
15 0.35
16 0.34
17 0.29
18 0.27
19 0.29
20 0.28
21 0.27
22 0.24
23 0.18
24 0.18
25 0.18
26 0.14
27 0.11
28 0.09
29 0.09
30 0.1
31 0.1
32 0.08
33 0.08
34 0.08
35 0.11
36 0.11
37 0.12
38 0.11
39 0.15
40 0.18
41 0.18
42 0.21
43 0.26
44 0.25
45 0.26
46 0.27
47 0.24
48 0.23
49 0.23
50 0.22
51 0.25
52 0.29
53 0.33
54 0.33
55 0.36
56 0.38
57 0.39
58 0.4
59 0.41
60 0.47
61 0.46
62 0.49
63 0.46
64 0.42
65 0.41
66 0.39
67 0.29
68 0.19
69 0.17
70 0.13
71 0.12
72 0.13
73 0.12
74 0.1
75 0.12
76 0.14
77 0.15
78 0.14
79 0.15
80 0.18
81 0.21
82 0.23
83 0.21
84 0.19
85 0.2
86 0.21
87 0.22
88 0.24
89 0.23
90 0.22
91 0.24
92 0.26
93 0.24
94 0.23
95 0.2
96 0.15
97 0.11
98 0.12
99 0.09
100 0.08
101 0.07
102 0.07
103 0.07
104 0.07
105 0.07
106 0.06
107 0.06
108 0.04
109 0.05
110 0.05
111 0.06
112 0.06
113 0.06
114 0.1
115 0.1
116 0.17
117 0.18
118 0.26
119 0.35
120 0.44
121 0.53
122 0.6
123 0.69
124 0.72
125 0.8
126 0.79