Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B0D750

Protein Details
Accession B0D750    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
274-293MPYAERRRAGKHTKRVIVRTHydrophilic
NLS Segment(s)
PositionSequence
279-287RRRAGKHTK
Subcellular Location(s) nucl 22, cyto_nucl 14.5, cyto 5
Family & Domain DBs
KEGG lbc:LACBIDRAFT_293836  -  
Amino Acid Sequences MSNFHLRPVSETSPSPSPTAPTTPPGDRSPPFKGPSSLYVSPPPPSSTNGRSHRRPLSPSSLRGELSTSRTGLSNLDALTPASDVDLTRSSDMPPRKYPAPPTGHDLMAMFPPAPPDSFSEMRPGPTSGYFQRQERAFFAQAGKEIVRVRVEVDLPENEPPKSSRTSSSRPWTGHSTPVPHHSPPPSSSAPLGYSHPTSRPSQRGPVPATAAPLFPATPSHAPPSQHPSDLHPHQTNSGLRTPPQDSTQPGAPTSKTEPQPDEYDPDESWRRPMPYAERRRAGKHTKRVIVRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.38
3 0.32
4 0.31
5 0.31
6 0.34
7 0.32
8 0.3
9 0.34
10 0.36
11 0.4
12 0.41
13 0.44
14 0.41
15 0.45
16 0.48
17 0.49
18 0.49
19 0.48
20 0.47
21 0.44
22 0.47
23 0.49
24 0.44
25 0.4
26 0.43
27 0.41
28 0.41
29 0.39
30 0.36
31 0.3
32 0.3
33 0.34
34 0.34
35 0.42
36 0.49
37 0.54
38 0.57
39 0.63
40 0.68
41 0.67
42 0.65
43 0.62
44 0.64
45 0.62
46 0.62
47 0.59
48 0.54
49 0.48
50 0.44
51 0.4
52 0.33
53 0.31
54 0.29
55 0.24
56 0.21
57 0.21
58 0.21
59 0.18
60 0.16
61 0.14
62 0.12
63 0.12
64 0.12
65 0.11
66 0.11
67 0.1
68 0.08
69 0.06
70 0.06
71 0.06
72 0.08
73 0.11
74 0.11
75 0.13
76 0.13
77 0.14
78 0.2
79 0.26
80 0.28
81 0.3
82 0.33
83 0.35
84 0.38
85 0.42
86 0.45
87 0.46
88 0.42
89 0.44
90 0.42
91 0.39
92 0.36
93 0.31
94 0.22
95 0.17
96 0.16
97 0.1
98 0.07
99 0.08
100 0.08
101 0.08
102 0.09
103 0.11
104 0.16
105 0.18
106 0.18
107 0.22
108 0.22
109 0.23
110 0.23
111 0.2
112 0.16
113 0.16
114 0.18
115 0.16
116 0.22
117 0.23
118 0.23
119 0.27
120 0.27
121 0.27
122 0.26
123 0.28
124 0.23
125 0.22
126 0.22
127 0.18
128 0.18
129 0.18
130 0.15
131 0.13
132 0.13
133 0.13
134 0.12
135 0.11
136 0.12
137 0.12
138 0.12
139 0.1
140 0.11
141 0.11
142 0.11
143 0.14
144 0.15
145 0.13
146 0.14
147 0.14
148 0.15
149 0.17
150 0.17
151 0.2
152 0.25
153 0.31
154 0.37
155 0.44
156 0.47
157 0.45
158 0.47
159 0.49
160 0.44
161 0.45
162 0.4
163 0.37
164 0.33
165 0.38
166 0.38
167 0.32
168 0.34
169 0.3
170 0.31
171 0.28
172 0.33
173 0.28
174 0.26
175 0.25
176 0.23
177 0.22
178 0.21
179 0.21
180 0.17
181 0.18
182 0.18
183 0.2
184 0.21
185 0.23
186 0.29
187 0.33
188 0.34
189 0.39
190 0.43
191 0.48
192 0.48
193 0.48
194 0.46
195 0.4
196 0.4
197 0.33
198 0.28
199 0.21
200 0.19
201 0.15
202 0.11
203 0.12
204 0.13
205 0.14
206 0.16
207 0.2
208 0.23
209 0.24
210 0.28
211 0.35
212 0.34
213 0.35
214 0.34
215 0.34
216 0.4
217 0.43
218 0.47
219 0.43
220 0.41
221 0.4
222 0.45
223 0.43
224 0.38
225 0.4
226 0.34
227 0.31
228 0.35
229 0.36
230 0.33
231 0.34
232 0.34
233 0.31
234 0.34
235 0.38
236 0.35
237 0.34
238 0.34
239 0.3
240 0.31
241 0.33
242 0.37
243 0.35
244 0.39
245 0.41
246 0.43
247 0.48
248 0.46
249 0.44
250 0.38
251 0.38
252 0.32
253 0.35
254 0.37
255 0.32
256 0.35
257 0.36
258 0.36
259 0.34
260 0.41
261 0.45
262 0.5
263 0.6
264 0.65
265 0.67
266 0.7
267 0.74
268 0.77
269 0.78
270 0.77
271 0.77
272 0.78
273 0.78