Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0D0R7

Protein Details
Accession B0D0R7    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
33-52PDPTTKPKPRKWHVVQWVSSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 10, nucl 9.5, mito_nucl 9, mito 7.5
Family & Domain DBs
KEGG lbc:LACBIDRAFT_313753  -  
Amino Acid Sequences MILFYFYLHHLEKMETCKVWKWYCNTSDAEVIPDPTTKPKPRKWHVVQWVSSLSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.23
3 0.24
4 0.27
5 0.33
6 0.34
7 0.35
8 0.35
9 0.38
10 0.39
11 0.41
12 0.38
13 0.33
14 0.32
15 0.28
16 0.26
17 0.19
18 0.18
19 0.15
20 0.14
21 0.13
22 0.16
23 0.24
24 0.29
25 0.37
26 0.44
27 0.54
28 0.61
29 0.71
30 0.73
31 0.77
32 0.8
33 0.81
34 0.76
35 0.71