Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0CYB4

Protein Details
Accession B0CYB4    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
5-34PLAQKKLVKKLHKTIKKASKARQVKRGVKEHydrophilic
96-116MVCPNQKRKIKQKEGEEVDKDHydrophilic
NLS Segment(s)
PositionSequence
9-43KKLVKKLHKTIKKASKARQVKRGVKEVVKGIRKGE
Subcellular Location(s) mito 16, mito_nucl 12.833, cyto_mito 9.833, nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002415  H/ACA_rnp_Nhp2-like  
IPR029064  L30e-like  
IPR004038  Ribosomal_L7Ae/L30e/S12e/Gad45  
IPR018492  Ribosomal_L7Ae/L8/Nhp2  
IPR004037  Ribosomal_L7Ae_CS  
Gene Ontology GO:0005730  C:nucleolus  
GO:1990904  C:ribonucleoprotein complex  
GO:0003723  F:RNA binding  
GO:0006364  P:rRNA processing  
KEGG lbc:LACBIDRAFT_245726  -  
Pfam View protein in Pfam  
PF01248  Ribosomal_L7Ae  
PROSITE View protein in PROSITE  
PS01082  RIBOSOMAL_L7AE  
Amino Acid Sequences PLAHPLAQKKLVKKLHKTIKKASKARQVKRGVKEVVKGIRKGEKGLLILAADINPIDIISHLPVLSEEAQIPYIFVASKEELGHASSTKRPTSCVMVCPNQKRKIKQKEGEEVDKDDDYREVYEECYKEVEKLNMRVLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.74
3 0.78
4 0.8
5 0.81
6 0.82
7 0.83
8 0.83
9 0.82
10 0.81
11 0.83
12 0.84
13 0.83
14 0.82
15 0.81
16 0.79
17 0.78
18 0.74
19 0.67
20 0.63
21 0.6
22 0.59
23 0.55
24 0.5
25 0.45
26 0.46
27 0.43
28 0.41
29 0.37
30 0.32
31 0.27
32 0.26
33 0.23
34 0.16
35 0.15
36 0.13
37 0.1
38 0.06
39 0.05
40 0.05
41 0.03
42 0.03
43 0.03
44 0.03
45 0.04
46 0.04
47 0.05
48 0.05
49 0.05
50 0.05
51 0.07
52 0.08
53 0.08
54 0.07
55 0.07
56 0.08
57 0.08
58 0.08
59 0.06
60 0.05
61 0.05
62 0.04
63 0.06
64 0.06
65 0.08
66 0.08
67 0.09
68 0.09
69 0.1
70 0.1
71 0.09
72 0.11
73 0.14
74 0.17
75 0.2
76 0.19
77 0.2
78 0.22
79 0.28
80 0.28
81 0.3
82 0.33
83 0.37
84 0.45
85 0.53
86 0.59
87 0.61
88 0.66
89 0.68
90 0.73
91 0.76
92 0.79
93 0.78
94 0.78
95 0.79
96 0.8
97 0.81
98 0.73
99 0.65
100 0.58
101 0.52
102 0.43
103 0.33
104 0.26
105 0.2
106 0.17
107 0.16
108 0.13
109 0.14
110 0.21
111 0.2
112 0.21
113 0.23
114 0.23
115 0.24
116 0.28
117 0.34
118 0.34
119 0.39