Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2Q5E6

Protein Details
Accession M2Q5E6    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
171-193VSLRCSAREKESKMNRDRRRKATHydrophilic
NLS Segment(s)
PositionSequence
186-191RDRRRK
Subcellular Location(s) mito 13.5, nucl 9.5, cyto_mito 9.333, cyto_nucl 7.333
Family & Domain DBs
Amino Acid Sequences MRNTPELGQALHGFVKTSLQNWLHDSEAWEYVQYVSMLGHVDNCAKISEWYRAGQSTVLDWNNGPDDGTVASLEAIFVKRAKEIVEEAAQSPDKFSAEERARIKVWEKKGYTPEDEEGEMVRVDEVKNEEVTGDLRSGQHILVSARVMTCYCSERRGNRAVSEHVESLLQVSLRCSAREKESKMNRDRRRKAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.19
3 0.16
4 0.16
5 0.22
6 0.22
7 0.25
8 0.27
9 0.29
10 0.26
11 0.26
12 0.28
13 0.23
14 0.23
15 0.21
16 0.18
17 0.16
18 0.15
19 0.16
20 0.13
21 0.1
22 0.08
23 0.09
24 0.09
25 0.08
26 0.09
27 0.08
28 0.1
29 0.1
30 0.11
31 0.1
32 0.1
33 0.12
34 0.14
35 0.18
36 0.19
37 0.2
38 0.21
39 0.22
40 0.21
41 0.21
42 0.18
43 0.15
44 0.18
45 0.17
46 0.16
47 0.15
48 0.16
49 0.16
50 0.15
51 0.13
52 0.08
53 0.08
54 0.08
55 0.08
56 0.06
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.05
63 0.06
64 0.07
65 0.07
66 0.07
67 0.08
68 0.09
69 0.09
70 0.1
71 0.12
72 0.13
73 0.13
74 0.14
75 0.16
76 0.16
77 0.14
78 0.14
79 0.11
80 0.1
81 0.09
82 0.09
83 0.15
84 0.16
85 0.22
86 0.23
87 0.26
88 0.26
89 0.27
90 0.31
91 0.29
92 0.33
93 0.35
94 0.35
95 0.37
96 0.43
97 0.45
98 0.44
99 0.4
100 0.36
101 0.29
102 0.28
103 0.23
104 0.18
105 0.15
106 0.12
107 0.09
108 0.08
109 0.07
110 0.06
111 0.08
112 0.1
113 0.1
114 0.1
115 0.1
116 0.1
117 0.1
118 0.11
119 0.1
120 0.08
121 0.08
122 0.08
123 0.09
124 0.1
125 0.09
126 0.09
127 0.1
128 0.1
129 0.1
130 0.11
131 0.1
132 0.1
133 0.11
134 0.1
135 0.1
136 0.12
137 0.14
138 0.15
139 0.2
140 0.26
141 0.3
142 0.37
143 0.42
144 0.43
145 0.44
146 0.48
147 0.47
148 0.46
149 0.45
150 0.39
151 0.33
152 0.29
153 0.24
154 0.21
155 0.18
156 0.14
157 0.1
158 0.1
159 0.16
160 0.18
161 0.19
162 0.22
163 0.24
164 0.32
165 0.41
166 0.45
167 0.5
168 0.59
169 0.67
170 0.74
171 0.81
172 0.82
173 0.85