Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2RS19

Protein Details
Accession M2RS19   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
105-124QVKWLKKLWITKKPNDSHYRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008335  Mopterin_OxRdtase_euk  
IPR000572  OxRdtase_Mopterin-bd_dom  
IPR036374  OxRdtase_Mopterin-bd_sf  
Gene Ontology GO:0016491  F:oxidoreductase activity  
Pfam View protein in Pfam  
PF00174  Oxidored_molyb  
Amino Acid Sequences MVKRSAAFNWSAAGVSTCMWRGIHIRDVLLASGLMEEPEIERWYLNFEGADEPSEGPYATSIPLAYAMDPANDVMLVFGQNGRVLHPDHGYPLRTIIPGMVGGRQVKWLKKLWITKKPNDSHYRMPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.1
3 0.11
4 0.11
5 0.12
6 0.12
7 0.13
8 0.15
9 0.19
10 0.24
11 0.23
12 0.23
13 0.23
14 0.24
15 0.22
16 0.18
17 0.14
18 0.08
19 0.07
20 0.07
21 0.05
22 0.05
23 0.05
24 0.05
25 0.07
26 0.08
27 0.07
28 0.07
29 0.07
30 0.11
31 0.12
32 0.11
33 0.09
34 0.09
35 0.11
36 0.11
37 0.13
38 0.09
39 0.09
40 0.09
41 0.1
42 0.09
43 0.07
44 0.07
45 0.06
46 0.05
47 0.05
48 0.05
49 0.04
50 0.05
51 0.05
52 0.05
53 0.06
54 0.06
55 0.06
56 0.06
57 0.06
58 0.05
59 0.05
60 0.05
61 0.03
62 0.03
63 0.04
64 0.04
65 0.04
66 0.04
67 0.06
68 0.06
69 0.07
70 0.09
71 0.1
72 0.12
73 0.13
74 0.13
75 0.16
76 0.19
77 0.2
78 0.18
79 0.19
80 0.18
81 0.17
82 0.17
83 0.13
84 0.11
85 0.12
86 0.12
87 0.11
88 0.13
89 0.14
90 0.14
91 0.21
92 0.24
93 0.26
94 0.3
95 0.35
96 0.38
97 0.45
98 0.55
99 0.58
100 0.64
101 0.69
102 0.74
103 0.79
104 0.79
105 0.81
106 0.8
107 0.76