Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2PV72

Protein Details
Accession M2PV72    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
19-48SEPEREEQRRQAKLRKKRKKKQESFKDVIEBasic
NLS Segment(s)
PositionSequence
27-39RRQAKLRKKRKKK
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MSHLSGRAWPKEVEVVVDSEPEREEQRRQAKLRKKRKKKQESFKDVIEITDDDTNSSAGSKSKRSRASPKLNSHSDVGKSYSAVYQKYRSNDPNVESSPGTEQDSATSPPTTMSNVTDPASMMLIAPSFPPFVSCWYCRVPPRSSFKTKRNLTPPIVKEERKKMETVYN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.2
4 0.23
5 0.21
6 0.17
7 0.17
8 0.16
9 0.18
10 0.19
11 0.23
12 0.29
13 0.38
14 0.46
15 0.51
16 0.59
17 0.66
18 0.74
19 0.81
20 0.83
21 0.85
22 0.87
23 0.92
24 0.93
25 0.94
26 0.95
27 0.95
28 0.93
29 0.87
30 0.8
31 0.74
32 0.62
33 0.51
34 0.42
35 0.31
36 0.23
37 0.2
38 0.17
39 0.12
40 0.13
41 0.12
42 0.1
43 0.1
44 0.09
45 0.09
46 0.12
47 0.18
48 0.23
49 0.31
50 0.37
51 0.43
52 0.52
53 0.59
54 0.67
55 0.69
56 0.74
57 0.74
58 0.7
59 0.66
60 0.58
61 0.51
62 0.42
63 0.34
64 0.26
65 0.19
66 0.16
67 0.15
68 0.16
69 0.15
70 0.15
71 0.15
72 0.17
73 0.21
74 0.23
75 0.27
76 0.27
77 0.3
78 0.32
79 0.32
80 0.33
81 0.31
82 0.31
83 0.26
84 0.24
85 0.21
86 0.19
87 0.19
88 0.14
89 0.13
90 0.12
91 0.14
92 0.14
93 0.14
94 0.13
95 0.11
96 0.12
97 0.12
98 0.12
99 0.11
100 0.12
101 0.13
102 0.14
103 0.15
104 0.15
105 0.14
106 0.13
107 0.13
108 0.1
109 0.08
110 0.06
111 0.06
112 0.06
113 0.06
114 0.06
115 0.07
116 0.06
117 0.08
118 0.08
119 0.13
120 0.19
121 0.19
122 0.23
123 0.27
124 0.32
125 0.37
126 0.42
127 0.43
128 0.45
129 0.54
130 0.58
131 0.65
132 0.68
133 0.7
134 0.75
135 0.76
136 0.78
137 0.77
138 0.77
139 0.73
140 0.75
141 0.7
142 0.69
143 0.71
144 0.67
145 0.66
146 0.69
147 0.71
148 0.63
149 0.61