Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1SBX5

Protein Details
Accession N1SBX5    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
66-108DLCEKHSRKKESHKRDPSKKPSHKKESRKKDPQKEDSHKKSEPBasic
139-161QEKLEKLDKKKKELHQEEKELKEBasic
NLS Segment(s)
PositionSequence
70-105KHSRKKESHKRDPSKKPSHKKESRKKDPQKEDSHKK
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
Amino Acid Sequences MADSNASGSHTIKKGAAEKLPENVAQNMPKLLTQGEPEGEQSQEDDSEEDELKNDGTKKKVRFKEDLCEKHSRKKESHKRDPSKKPSHKKESRKKDPQKEDSHKKSEPKSCRIGLFDSYTLRRFEGMWNKRLADLKDVQEKLEKLDKKKKELHQEEKELKEWLNRLHESIKNKRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.34
3 0.37
4 0.37
5 0.38
6 0.4
7 0.41
8 0.39
9 0.36
10 0.33
11 0.33
12 0.29
13 0.28
14 0.25
15 0.23
16 0.21
17 0.2
18 0.17
19 0.15
20 0.14
21 0.16
22 0.16
23 0.16
24 0.18
25 0.18
26 0.17
27 0.15
28 0.14
29 0.12
30 0.11
31 0.1
32 0.09
33 0.08
34 0.1
35 0.11
36 0.1
37 0.1
38 0.1
39 0.09
40 0.12
41 0.15
42 0.16
43 0.21
44 0.28
45 0.35
46 0.44
47 0.51
48 0.54
49 0.58
50 0.59
51 0.64
52 0.67
53 0.67
54 0.62
55 0.66
56 0.62
57 0.63
58 0.66
59 0.61
60 0.56
61 0.61
62 0.66
63 0.67
64 0.76
65 0.78
66 0.81
67 0.86
68 0.91
69 0.9
70 0.91
71 0.9
72 0.89
73 0.88
74 0.89
75 0.88
76 0.88
77 0.88
78 0.89
79 0.89
80 0.9
81 0.9
82 0.9
83 0.9
84 0.89
85 0.89
86 0.88
87 0.87
88 0.84
89 0.81
90 0.75
91 0.71
92 0.69
93 0.67
94 0.65
95 0.61
96 0.59
97 0.55
98 0.53
99 0.5
100 0.45
101 0.39
102 0.35
103 0.31
104 0.28
105 0.27
106 0.27
107 0.25
108 0.23
109 0.2
110 0.17
111 0.22
112 0.3
113 0.33
114 0.36
115 0.39
116 0.39
117 0.42
118 0.46
119 0.4
120 0.35
121 0.35
122 0.35
123 0.41
124 0.41
125 0.39
126 0.39
127 0.38
128 0.37
129 0.4
130 0.4
131 0.4
132 0.49
133 0.55
134 0.57
135 0.66
136 0.7
137 0.73
138 0.78
139 0.8
140 0.8
141 0.84
142 0.84
143 0.8
144 0.74
145 0.65
146 0.55
147 0.5
148 0.45
149 0.41
150 0.41
151 0.37
152 0.39
153 0.43
154 0.47
155 0.5