Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q59ZW4

Protein Details
Accession Q59ZW4   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
89-115KNTKIAPKSNNNKKKSKPNAYEVQPHYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR011107  PPI_Ypi1  
Gene Ontology GO:0005634  C:nucleus  
GO:0008157  F:protein phosphatase 1 binding  
GO:0004865  F:protein serine/threonine phosphatase inhibitor activity  
GO:0030447  P:filamentous growth  
GO:0032515  P:negative regulation of phosphoprotein phosphatase activity  
KEGG cal:CAALFM_C114190CA  -  
Pfam View protein in Pfam  
PF07491  PPI_Ypi1  
Amino Acid Sequences MSQQRENQRGIVSQTTTTTASPILKLRAQERQARDVSWDANVVDNEHLNKKKTKICCIFHPSDRNCDEEDSSSSSDSSSDSSDNEEDDKNTKIAPKSNNNKKKSKPNAYEVQPHYKNQSKVPGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.27
4 0.23
5 0.2
6 0.17
7 0.16
8 0.17
9 0.19
10 0.2
11 0.21
12 0.24
13 0.26
14 0.33
15 0.36
16 0.42
17 0.43
18 0.46
19 0.46
20 0.43
21 0.43
22 0.36
23 0.32
24 0.25
25 0.22
26 0.15
27 0.16
28 0.16
29 0.14
30 0.12
31 0.13
32 0.14
33 0.18
34 0.21
35 0.2
36 0.24
37 0.27
38 0.32
39 0.36
40 0.43
41 0.46
42 0.47
43 0.53
44 0.57
45 0.57
46 0.57
47 0.62
48 0.53
49 0.52
50 0.49
51 0.43
52 0.36
53 0.33
54 0.28
55 0.21
56 0.21
57 0.18
58 0.17
59 0.15
60 0.14
61 0.13
62 0.12
63 0.11
64 0.1
65 0.08
66 0.08
67 0.08
68 0.11
69 0.11
70 0.11
71 0.13
72 0.13
73 0.13
74 0.14
75 0.16
76 0.13
77 0.14
78 0.18
79 0.19
80 0.25
81 0.31
82 0.4
83 0.49
84 0.6
85 0.69
86 0.71
87 0.77
88 0.79
89 0.82
90 0.83
91 0.83
92 0.8
93 0.79
94 0.82
95 0.79
96 0.81
97 0.76
98 0.75
99 0.68
100 0.63
101 0.62
102 0.61
103 0.58
104 0.53