Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1RAJ7

Protein Details
Accession N1RAJ7   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
8-32SHLPGQPKYARHKREKQGSPKLLFVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 10, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
IPR018712  DUF2235  
Pfam View protein in Pfam  
PF09994  DUF2235  
Amino Acid Sequences MNSSSILSHLPGQPKYARHKREKQGSPKLLFVAFDGTWHGSVKSSKETVVSSLPDLISMGEEVRKIRVNGVGTDNLTDKVLGGLGGWGTRRNVITAYRNIADDYNKGDRIIFCGYSRGAWAARYLAMIIECLGLVRDGDTEFFKRLYDACKKDPYLTKANKDDLRRNYKCWS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.48
3 0.54
4 0.59
5 0.63
6 0.72
7 0.78
8 0.84
9 0.87
10 0.87
11 0.88
12 0.88
13 0.81
14 0.74
15 0.66
16 0.56
17 0.46
18 0.36
19 0.3
20 0.2
21 0.17
22 0.17
23 0.15
24 0.15
25 0.15
26 0.15
27 0.12
28 0.14
29 0.17
30 0.19
31 0.19
32 0.19
33 0.2
34 0.2
35 0.2
36 0.21
37 0.2
38 0.16
39 0.17
40 0.16
41 0.14
42 0.14
43 0.11
44 0.08
45 0.07
46 0.07
47 0.06
48 0.07
49 0.07
50 0.1
51 0.12
52 0.12
53 0.13
54 0.16
55 0.17
56 0.18
57 0.21
58 0.21
59 0.18
60 0.19
61 0.19
62 0.15
63 0.14
64 0.11
65 0.08
66 0.06
67 0.06
68 0.05
69 0.04
70 0.03
71 0.03
72 0.04
73 0.04
74 0.05
75 0.06
76 0.07
77 0.07
78 0.08
79 0.09
80 0.12
81 0.16
82 0.18
83 0.21
84 0.21
85 0.21
86 0.21
87 0.21
88 0.19
89 0.15
90 0.17
91 0.18
92 0.18
93 0.17
94 0.18
95 0.17
96 0.19
97 0.21
98 0.17
99 0.14
100 0.16
101 0.16
102 0.15
103 0.16
104 0.14
105 0.12
106 0.11
107 0.11
108 0.1
109 0.1
110 0.1
111 0.1
112 0.09
113 0.08
114 0.08
115 0.07
116 0.06
117 0.05
118 0.05
119 0.05
120 0.05
121 0.05
122 0.05
123 0.05
124 0.06
125 0.07
126 0.1
127 0.12
128 0.14
129 0.14
130 0.14
131 0.14
132 0.16
133 0.22
134 0.29
135 0.34
136 0.38
137 0.46
138 0.48
139 0.55
140 0.62
141 0.6
142 0.61
143 0.63
144 0.65
145 0.64
146 0.71
147 0.7
148 0.69
149 0.72
150 0.72
151 0.74
152 0.7