Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1RCQ5

Protein Details
Accession N1RCQ5    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
112-138VKLANKKAEKANKKKNNKTKESKEDLLHydrophilic
NLS Segment(s)
PositionSequence
116-172NKKAEKANKKKNNKTKESKEDLLKEKAELTKEKVGLTKERAALVKALKVKKAEKIRA
Subcellular Location(s) nucl 15, cyto_nucl 14.5, cyto 10
Family & Domain DBs
Amino Acid Sequences MHEPTIQIITRPPEPLDAELKPEPQVIWRDKNGKIYFRNNPTLPILRYPNSKAIEKPDDAPDKCKSCTRECLVAIPNEEIEKEIRELELDVEKDFEVPEAKKPEPNIDIEMVKLANKKAEKANKKKNNKTKESKEDLLKEKAELTKEKVGLTKERAALVKALKVKKAEKIRAETPAKTTAKTIAEMKKLSEFISVRIKRYNRHGAPLSEKMAEEDLKYTIEKMYKHLPNSFVDWEYEEDVDVCRILDLPCYGKSFGKNIEDHLYGKEHLAYDRSMKGRVPLCVQHNRVKREIENGLSYQEGLLAELSVDPYSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.33
3 0.34
4 0.3
5 0.33
6 0.33
7 0.34
8 0.31
9 0.3
10 0.26
11 0.26
12 0.33
13 0.34
14 0.39
15 0.44
16 0.49
17 0.51
18 0.61
19 0.61
20 0.61
21 0.61
22 0.62
23 0.65
24 0.66
25 0.71
26 0.62
27 0.6
28 0.58
29 0.57
30 0.51
31 0.48
32 0.46
33 0.41
34 0.46
35 0.46
36 0.48
37 0.45
38 0.45
39 0.42
40 0.44
41 0.47
42 0.44
43 0.43
44 0.44
45 0.49
46 0.48
47 0.5
48 0.48
49 0.46
50 0.46
51 0.48
52 0.44
53 0.41
54 0.49
55 0.5
56 0.5
57 0.47
58 0.52
59 0.5
60 0.48
61 0.44
62 0.36
63 0.31
64 0.24
65 0.23
66 0.17
67 0.14
68 0.13
69 0.11
70 0.11
71 0.1
72 0.1
73 0.1
74 0.11
75 0.14
76 0.13
77 0.12
78 0.13
79 0.13
80 0.13
81 0.12
82 0.11
83 0.1
84 0.11
85 0.17
86 0.21
87 0.22
88 0.24
89 0.25
90 0.3
91 0.29
92 0.3
93 0.27
94 0.24
95 0.24
96 0.21
97 0.21
98 0.16
99 0.15
100 0.15
101 0.13
102 0.15
103 0.15
104 0.18
105 0.24
106 0.34
107 0.42
108 0.51
109 0.62
110 0.67
111 0.77
112 0.84
113 0.87
114 0.87
115 0.87
116 0.86
117 0.85
118 0.85
119 0.82
120 0.77
121 0.73
122 0.7
123 0.65
124 0.6
125 0.5
126 0.41
127 0.36
128 0.33
129 0.3
130 0.25
131 0.24
132 0.25
133 0.25
134 0.26
135 0.26
136 0.25
137 0.26
138 0.28
139 0.29
140 0.25
141 0.26
142 0.25
143 0.23
144 0.24
145 0.21
146 0.21
147 0.22
148 0.22
149 0.23
150 0.26
151 0.27
152 0.31
153 0.39
154 0.41
155 0.4
156 0.44
157 0.44
158 0.5
159 0.52
160 0.46
161 0.41
162 0.44
163 0.4
164 0.34
165 0.32
166 0.28
167 0.26
168 0.26
169 0.29
170 0.26
171 0.29
172 0.29
173 0.3
174 0.28
175 0.27
176 0.26
177 0.25
178 0.2
179 0.19
180 0.29
181 0.3
182 0.29
183 0.35
184 0.37
185 0.35
186 0.43
187 0.51
188 0.42
189 0.47
190 0.49
191 0.46
192 0.51
193 0.52
194 0.46
195 0.37
196 0.35
197 0.29
198 0.27
199 0.23
200 0.17
201 0.14
202 0.12
203 0.12
204 0.12
205 0.12
206 0.12
207 0.15
208 0.15
209 0.17
210 0.26
211 0.29
212 0.33
213 0.36
214 0.36
215 0.35
216 0.39
217 0.38
218 0.3
219 0.26
220 0.24
221 0.23
222 0.21
223 0.19
224 0.15
225 0.12
226 0.12
227 0.11
228 0.1
229 0.08
230 0.06
231 0.07
232 0.07
233 0.09
234 0.11
235 0.13
236 0.16
237 0.19
238 0.2
239 0.22
240 0.24
241 0.26
242 0.3
243 0.33
244 0.31
245 0.32
246 0.36
247 0.36
248 0.34
249 0.33
250 0.3
251 0.25
252 0.25
253 0.23
254 0.19
255 0.18
256 0.19
257 0.19
258 0.2
259 0.26
260 0.27
261 0.27
262 0.26
263 0.32
264 0.34
265 0.36
266 0.37
267 0.37
268 0.43
269 0.51
270 0.56
271 0.59
272 0.63
273 0.65
274 0.64
275 0.63
276 0.57
277 0.56
278 0.56
279 0.52
280 0.49
281 0.44
282 0.41
283 0.36
284 0.33
285 0.25
286 0.21
287 0.16
288 0.11
289 0.1
290 0.08
291 0.08
292 0.08
293 0.1