Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D8PU30

Protein Details
Accession A0A1D8PU30   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
24-50LLLLNKGRKKKWEKKKKKLFYSCSVQFHydrophilic
NLS Segment(s)
PositionSequence
29-41KGRKKKWEKKKKK
Subcellular Location(s) nucl 7, cyto_nucl 6.5, extr 5, cyto 4, E.R. 4, pero 2, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
GO:0009267  P:cellular response to starvation  
GO:0030447  P:filamentous growth  
GO:0036180  P:filamentous growth of a population of unicellular organisms in response to biotic stimulus  
GO:0036170  P:filamentous growth of a population of unicellular organisms in response to starvation  
KEGG cal:CAALFM_CR09850CA  -  
Amino Acid Sequences MFKTDFFFFNLCMESVLLVLFFSLLLLNKGRKKKWEKKKKKLFYSCSVQFYSVVIVVDCSVNPVKKQKKANIFQSRSIAALTTQLFNFFSCKRVYNDSSIQKYSCVDLKRIKVSSKSLAC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.1
4 0.07
5 0.06
6 0.05
7 0.04
8 0.04
9 0.03
10 0.04
11 0.05
12 0.06
13 0.09
14 0.15
15 0.22
16 0.29
17 0.32
18 0.41
19 0.51
20 0.6
21 0.68
22 0.75
23 0.8
24 0.84
25 0.92
26 0.93
27 0.94
28 0.94
29 0.9
30 0.86
31 0.84
32 0.78
33 0.71
34 0.62
35 0.51
36 0.41
37 0.34
38 0.27
39 0.18
40 0.13
41 0.08
42 0.07
43 0.06
44 0.06
45 0.06
46 0.07
47 0.07
48 0.08
49 0.09
50 0.18
51 0.23
52 0.3
53 0.37
54 0.42
55 0.51
56 0.57
57 0.67
58 0.7
59 0.68
60 0.65
61 0.62
62 0.55
63 0.46
64 0.39
65 0.28
66 0.17
67 0.17
68 0.14
69 0.12
70 0.12
71 0.12
72 0.13
73 0.13
74 0.16
75 0.13
76 0.14
77 0.15
78 0.18
79 0.2
80 0.27
81 0.3
82 0.33
83 0.41
84 0.47
85 0.51
86 0.51
87 0.48
88 0.43
89 0.4
90 0.37
91 0.34
92 0.28
93 0.29
94 0.33
95 0.4
96 0.47
97 0.5
98 0.53
99 0.52
100 0.56