Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1RVJ6

Protein Details
Accession N1RVJ6    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
14-40RLAARASSARKERRKRSQAPKDKVAKAHydrophilic
NLS Segment(s)
PositionSequence
12-79KNRLAARASSARKERRKRSQAPKDKVAKADTTRGARPGLLPTSGPRAKLSAKKARKMEKRLAHAMKRK
Subcellular Location(s) nucl 20, cyto 4, mito 3
Family & Domain DBs
Amino Acid Sequences MPSVGNPNGPSKNRLAARASSARKERRKRSQAPKDKVAKADTTRGARPGLLPTSGPRAKLSAKKARKMEKRLAHAMKRKMEAEGEAEMKDAPEVEGEKAEEVEMGDIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.42
3 0.37
4 0.42
5 0.48
6 0.49
7 0.48
8 0.54
9 0.59
10 0.65
11 0.72
12 0.75
13 0.76
14 0.82
15 0.85
16 0.88
17 0.89
18 0.9
19 0.88
20 0.88
21 0.86
22 0.8
23 0.73
24 0.65
25 0.59
26 0.51
27 0.49
28 0.45
29 0.4
30 0.36
31 0.34
32 0.32
33 0.26
34 0.24
35 0.21
36 0.17
37 0.14
38 0.13
39 0.12
40 0.2
41 0.21
42 0.2
43 0.17
44 0.18
45 0.22
46 0.27
47 0.34
48 0.37
49 0.42
50 0.49
51 0.56
52 0.63
53 0.69
54 0.7
55 0.72
56 0.69
57 0.7
58 0.72
59 0.73
60 0.72
61 0.71
62 0.71
63 0.68
64 0.63
65 0.57
66 0.49
67 0.42
68 0.35
69 0.3
70 0.26
71 0.22
72 0.18
73 0.18
74 0.16
75 0.15
76 0.13
77 0.11
78 0.07
79 0.08
80 0.09
81 0.1
82 0.12
83 0.13
84 0.13
85 0.13
86 0.13
87 0.11
88 0.1