Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1RR95

Protein Details
Accession N1RR95   
Localization Confidence High
Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
12-60GGALKLKGAKIHKKKKKRDKTDLEKNLDTGNKDEEKRKKKDREEQEPHDBasic
NLS Segment(s)
PositionSequence
15-32LKLKGAKIHKKKKKRDKT
44-51DEEKRKKK
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MGSDDYAAVGGGGALKLKGAKIHKKKKKRDKTDLEKNLDTGNKDEEKRKKKDREEQEPHDEDDEDKPELLKLAESSSSRPELLKTHKERVEELNTYLSRLSEHHDMPRIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.06
4 0.07
5 0.13
6 0.2
7 0.3
8 0.41
9 0.52
10 0.62
11 0.72
12 0.83
13 0.89
14 0.92
15 0.93
16 0.93
17 0.93
18 0.93
19 0.94
20 0.93
21 0.89
22 0.79
23 0.69
24 0.61
25 0.52
26 0.42
27 0.32
28 0.28
29 0.25
30 0.25
31 0.32
32 0.38
33 0.44
34 0.51
35 0.59
36 0.63
37 0.68
38 0.76
39 0.78
40 0.8
41 0.8
42 0.79
43 0.78
44 0.71
45 0.63
46 0.54
47 0.44
48 0.34
49 0.27
50 0.22
51 0.14
52 0.12
53 0.11
54 0.1
55 0.11
56 0.1
57 0.08
58 0.06
59 0.07
60 0.11
61 0.11
62 0.13
63 0.16
64 0.18
65 0.17
66 0.17
67 0.17
68 0.2
69 0.28
70 0.36
71 0.39
72 0.46
73 0.49
74 0.5
75 0.52
76 0.53
77 0.52
78 0.45
79 0.41
80 0.4
81 0.37
82 0.36
83 0.34
84 0.27
85 0.21
86 0.19
87 0.22
88 0.2
89 0.23
90 0.28
91 0.34
92 0.35