Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1R8J7

Protein Details
Accession N1R8J7    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
27-46NRSDEKKTPRTMRPNPEPTPHydrophilic
NLS Segment(s)
PositionSequence
63-71KHQQRPKRR
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MATTDKPRRRFVPEPIETTFSTSRSSNRSDEKKTPRTMRPNPEPTPEPSPRSPSPGLNELQKKHQQRPKRRFAPQLIESSRRSRRVGDAGPATKPTDKTDITPYTKNIYTATKHRGRTGGEPVFEVLAWLYVKLSAIVGLKDDLSTVIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.63
3 0.62
4 0.53
5 0.52
6 0.44
7 0.34
8 0.3
9 0.26
10 0.26
11 0.26
12 0.31
13 0.3
14 0.38
15 0.44
16 0.49
17 0.57
18 0.64
19 0.68
20 0.72
21 0.74
22 0.74
23 0.77
24 0.79
25 0.79
26 0.8
27 0.8
28 0.75
29 0.73
30 0.67
31 0.61
32 0.6
33 0.54
34 0.49
35 0.43
36 0.46
37 0.41
38 0.45
39 0.42
40 0.37
41 0.36
42 0.36
43 0.35
44 0.35
45 0.39
46 0.34
47 0.4
48 0.44
49 0.44
50 0.48
51 0.53
52 0.56
53 0.61
54 0.7
55 0.73
56 0.75
57 0.77
58 0.76
59 0.76
60 0.75
61 0.68
62 0.67
63 0.59
64 0.55
65 0.5
66 0.49
67 0.48
68 0.44
69 0.4
70 0.33
71 0.34
72 0.36
73 0.36
74 0.34
75 0.36
76 0.34
77 0.34
78 0.34
79 0.31
80 0.27
81 0.26
82 0.24
83 0.22
84 0.21
85 0.22
86 0.28
87 0.34
88 0.36
89 0.38
90 0.37
91 0.37
92 0.37
93 0.36
94 0.3
95 0.27
96 0.27
97 0.31
98 0.38
99 0.4
100 0.41
101 0.44
102 0.46
103 0.45
104 0.47
105 0.5
106 0.46
107 0.4
108 0.39
109 0.36
110 0.32
111 0.29
112 0.23
113 0.13
114 0.1
115 0.1
116 0.09
117 0.08
118 0.08
119 0.08
120 0.09
121 0.09
122 0.09
123 0.1
124 0.1
125 0.12
126 0.12
127 0.12
128 0.12
129 0.12