Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0CZN0

Protein Details
Accession B0CZN0    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
180-203GKKRMFKGHKWERVKAHRERRQNIBasic
206-240RDMAKRVYNYKNYYKRRRPNPLKPPRTTKAPKLPFHydrophilic
NLS Segment(s)
PositionSequence
162-201EKKRLEKPGAALGTRLYAGKKRMFKGHKWERVKAHRERRQ
220-237KRRRPNPLKPPRTTKAPK
Subcellular Location(s) mito_nucl 9.833, mito 9.5, cyto_nucl 9.333, nucl 9, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037507  MrpL25  
IPR040922  MRPL25_dom  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
KEGG lbc:LACBIDRAFT_292695  -  
Pfam View protein in Pfam  
PF18126  Mitoc_mL59  
Amino Acid Sequences MSTAAAREAVKRFRLGQFKFRNLHHHPKIFGPPLEPTNPISALDFPNPFIPWRTKSGKWTAPTYSLRRQAELVKKAKLSGFLHLLPPGPKTPKYIPQPVKVLDETPEHTPNGAETSGSVSEEPVVKMTMKQLDDAADDKLAMQAPYEWLVGPGREGCEAFREKKRLEKPGAALGTRLYAGKKRMFKGHKWERVKAHRERRQNILMRDMAKRVYNYKNYYKRRRPNPLKPPRTTKAPKLPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.51
3 0.56
4 0.59
5 0.65
6 0.67
7 0.66
8 0.68
9 0.66
10 0.73
11 0.71
12 0.68
13 0.61
14 0.61
15 0.66
16 0.63
17 0.56
18 0.48
19 0.43
20 0.42
21 0.42
22 0.38
23 0.32
24 0.29
25 0.28
26 0.26
27 0.23
28 0.21
29 0.21
30 0.24
31 0.22
32 0.2
33 0.21
34 0.21
35 0.21
36 0.22
37 0.24
38 0.23
39 0.29
40 0.34
41 0.35
42 0.41
43 0.49
44 0.52
45 0.5
46 0.52
47 0.48
48 0.5
49 0.53
50 0.53
51 0.53
52 0.54
53 0.52
54 0.48
55 0.47
56 0.47
57 0.5
58 0.52
59 0.48
60 0.44
61 0.43
62 0.44
63 0.43
64 0.41
65 0.34
66 0.29
67 0.28
68 0.25
69 0.26
70 0.25
71 0.26
72 0.2
73 0.2
74 0.2
75 0.2
76 0.2
77 0.24
78 0.27
79 0.34
80 0.39
81 0.47
82 0.49
83 0.51
84 0.54
85 0.51
86 0.51
87 0.43
88 0.37
89 0.3
90 0.26
91 0.23
92 0.22
93 0.22
94 0.18
95 0.17
96 0.16
97 0.14
98 0.14
99 0.12
100 0.08
101 0.06
102 0.09
103 0.09
104 0.09
105 0.09
106 0.06
107 0.07
108 0.08
109 0.08
110 0.06
111 0.07
112 0.07
113 0.07
114 0.1
115 0.13
116 0.13
117 0.13
118 0.13
119 0.13
120 0.15
121 0.15
122 0.13
123 0.09
124 0.08
125 0.08
126 0.09
127 0.08
128 0.07
129 0.06
130 0.06
131 0.07
132 0.09
133 0.09
134 0.08
135 0.08
136 0.09
137 0.08
138 0.09
139 0.09
140 0.08
141 0.09
142 0.09
143 0.09
144 0.13
145 0.17
146 0.21
147 0.27
148 0.31
149 0.32
150 0.4
151 0.47
152 0.5
153 0.52
154 0.53
155 0.5
156 0.53
157 0.55
158 0.46
159 0.4
160 0.32
161 0.28
162 0.22
163 0.2
164 0.13
165 0.14
166 0.19
167 0.25
168 0.32
169 0.34
170 0.43
171 0.48
172 0.53
173 0.6
174 0.66
175 0.69
176 0.7
177 0.74
178 0.74
179 0.79
180 0.81
181 0.8
182 0.8
183 0.79
184 0.82
185 0.79
186 0.77
187 0.77
188 0.76
189 0.69
190 0.66
191 0.62
192 0.55
193 0.54
194 0.48
195 0.42
196 0.37
197 0.36
198 0.35
199 0.39
200 0.44
201 0.48
202 0.56
203 0.64
204 0.71
205 0.79
206 0.84
207 0.85
208 0.87
209 0.92
210 0.92
211 0.93
212 0.93
213 0.94
214 0.93
215 0.92
216 0.91
217 0.86
218 0.86
219 0.83
220 0.82