Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1RBR1

Protein Details
Accession N1RBR1    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
26-46TSSSSLRHRRHHAPTINRYELHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 8extr 8, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MASSSWSASTTTCTCLTSTVLAGTETSSSSLRHRRHHAPTINRYELHRRKDEDEVKEIVNKETPSKTEAKSKATTVTIQRAAKTAAATNTPLPEAFDGNLSAELSTTSDSNCPAFLNGILSDPSYETCYPLSMMLQTSRGFFEAQKQLLSIVRVLDATCAANVTYCTDFFDAAARNLTASENCKQEWESGNTIVKQFLYGMKAYEMMYKATCLQTPEDDMYCYANAVTNTTTAANAYFYYLPYNLTLPGSTNPSCSWCIQETMNIFHAAAEDRSQPVALTYESAARQVNTLCGPDFVNSTLPPEETNLAHIFAPSWVGLVLALGSAALVNAVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.23
4 0.19
5 0.18
6 0.16
7 0.15
8 0.15
9 0.14
10 0.14
11 0.13
12 0.11
13 0.12
14 0.11
15 0.12
16 0.19
17 0.28
18 0.33
19 0.4
20 0.48
21 0.55
22 0.63
23 0.72
24 0.74
25 0.76
26 0.8
27 0.82
28 0.8
29 0.72
30 0.68
31 0.69
32 0.68
33 0.65
34 0.62
35 0.57
36 0.55
37 0.63
38 0.67
39 0.62
40 0.59
41 0.54
42 0.48
43 0.48
44 0.46
45 0.37
46 0.34
47 0.29
48 0.28
49 0.28
50 0.28
51 0.28
52 0.32
53 0.32
54 0.37
55 0.41
56 0.43
57 0.43
58 0.43
59 0.43
60 0.4
61 0.43
62 0.38
63 0.41
64 0.42
65 0.41
66 0.4
67 0.37
68 0.36
69 0.32
70 0.28
71 0.24
72 0.19
73 0.19
74 0.2
75 0.19
76 0.19
77 0.18
78 0.17
79 0.15
80 0.13
81 0.13
82 0.11
83 0.11
84 0.1
85 0.1
86 0.11
87 0.1
88 0.08
89 0.07
90 0.07
91 0.07
92 0.07
93 0.06
94 0.06
95 0.07
96 0.08
97 0.09
98 0.09
99 0.08
100 0.08
101 0.09
102 0.08
103 0.09
104 0.08
105 0.09
106 0.09
107 0.09
108 0.09
109 0.09
110 0.09
111 0.11
112 0.1
113 0.1
114 0.1
115 0.11
116 0.11
117 0.11
118 0.1
119 0.08
120 0.09
121 0.09
122 0.11
123 0.11
124 0.12
125 0.12
126 0.12
127 0.12
128 0.11
129 0.17
130 0.2
131 0.21
132 0.2
133 0.19
134 0.19
135 0.2
136 0.2
137 0.14
138 0.09
139 0.08
140 0.08
141 0.08
142 0.08
143 0.07
144 0.06
145 0.05
146 0.05
147 0.05
148 0.05
149 0.05
150 0.07
151 0.07
152 0.07
153 0.08
154 0.08
155 0.09
156 0.08
157 0.11
158 0.1
159 0.1
160 0.11
161 0.09
162 0.09
163 0.09
164 0.1
165 0.08
166 0.1
167 0.13
168 0.14
169 0.14
170 0.15
171 0.15
172 0.18
173 0.21
174 0.22
175 0.22
176 0.23
177 0.26
178 0.26
179 0.26
180 0.23
181 0.18
182 0.14
183 0.13
184 0.11
185 0.11
186 0.1
187 0.1
188 0.1
189 0.12
190 0.12
191 0.14
192 0.13
193 0.12
194 0.12
195 0.12
196 0.14
197 0.14
198 0.14
199 0.13
200 0.13
201 0.13
202 0.16
203 0.17
204 0.16
205 0.16
206 0.15
207 0.15
208 0.14
209 0.12
210 0.1
211 0.1
212 0.09
213 0.1
214 0.1
215 0.09
216 0.1
217 0.1
218 0.1
219 0.08
220 0.08
221 0.07
222 0.07
223 0.09
224 0.09
225 0.09
226 0.11
227 0.11
228 0.12
229 0.12
230 0.12
231 0.11
232 0.11
233 0.11
234 0.11
235 0.13
236 0.18
237 0.17
238 0.18
239 0.18
240 0.21
241 0.23
242 0.21
243 0.24
244 0.2
245 0.22
246 0.2
247 0.24
248 0.24
249 0.25
250 0.27
251 0.23
252 0.21
253 0.19
254 0.19
255 0.16
256 0.15
257 0.13
258 0.13
259 0.13
260 0.14
261 0.14
262 0.13
263 0.12
264 0.13
265 0.11
266 0.11
267 0.11
268 0.15
269 0.15
270 0.17
271 0.17
272 0.16
273 0.17
274 0.16
275 0.19
276 0.16
277 0.18
278 0.17
279 0.17
280 0.18
281 0.17
282 0.18
283 0.16
284 0.17
285 0.16
286 0.19
287 0.19
288 0.19
289 0.18
290 0.19
291 0.2
292 0.17
293 0.22
294 0.19
295 0.19
296 0.19
297 0.18
298 0.16
299 0.14
300 0.15
301 0.11
302 0.1
303 0.08
304 0.08
305 0.07
306 0.07
307 0.06
308 0.04
309 0.04
310 0.03
311 0.03
312 0.03
313 0.03