Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1RA18

Protein Details
Accession N1RA18   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
63-89LRERNRTAKRASRARQRQREQHNDTTAHydrophilic
NLS Segment(s)
PositionSequence
65-77ERNRTAKRASRAR
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039323  ANKRD60  
IPR002110  Ankyrin_rpt  
IPR036770  Ankyrin_rpt-contain_sf  
Pfam View protein in Pfam  
PF12796  Ank_2  
PROSITE View protein in PROSITE  
PS50297  ANK_REP_REGION  
PS50088  ANK_REPEAT  
Amino Acid Sequences MATTSEAHSWLRDLTLQYWEAKPGHDRLYVASRVTVSWLFIETEELEGCVLFASPKQQETHRLRERNRTAKRASRARQRQREQHNDTTADVATAEATAQDVDVAPPLQPPQHPGSGSGSDSVCVRAEASEDLDVWALDGPLDDPTALPWPSSLDEDWPEPRAPPASSSSLTSNSNDFNSKSLRLLHIAARNGTTGILLSLIKAGADVNSRDCSGTTPLHIAVRFRRASALELLVSHGANMNARDSANMTALEGAVRAQDEHVNIPLSGGAELH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.22
3 0.24
4 0.26
5 0.26
6 0.29
7 0.27
8 0.27
9 0.29
10 0.29
11 0.32
12 0.31
13 0.3
14 0.3
15 0.36
16 0.37
17 0.33
18 0.3
19 0.26
20 0.23
21 0.26
22 0.22
23 0.16
24 0.14
25 0.15
26 0.13
27 0.13
28 0.15
29 0.12
30 0.13
31 0.12
32 0.11
33 0.1
34 0.09
35 0.08
36 0.06
37 0.06
38 0.04
39 0.05
40 0.1
41 0.12
42 0.15
43 0.18
44 0.2
45 0.3
46 0.37
47 0.47
48 0.51
49 0.58
50 0.6
51 0.69
52 0.76
53 0.77
54 0.78
55 0.75
56 0.73
57 0.73
58 0.78
59 0.77
60 0.76
61 0.76
62 0.79
63 0.82
64 0.86
65 0.85
66 0.85
67 0.85
68 0.88
69 0.85
70 0.82
71 0.77
72 0.68
73 0.6
74 0.52
75 0.42
76 0.31
77 0.23
78 0.14
79 0.08
80 0.07
81 0.06
82 0.03
83 0.04
84 0.03
85 0.03
86 0.03
87 0.03
88 0.03
89 0.05
90 0.05
91 0.05
92 0.06
93 0.07
94 0.08
95 0.08
96 0.12
97 0.15
98 0.18
99 0.18
100 0.19
101 0.22
102 0.23
103 0.23
104 0.21
105 0.17
106 0.14
107 0.14
108 0.14
109 0.1
110 0.08
111 0.07
112 0.06
113 0.07
114 0.07
115 0.08
116 0.07
117 0.07
118 0.07
119 0.07
120 0.07
121 0.06
122 0.06
123 0.04
124 0.04
125 0.03
126 0.04
127 0.04
128 0.04
129 0.04
130 0.04
131 0.05
132 0.08
133 0.08
134 0.07
135 0.07
136 0.09
137 0.1
138 0.11
139 0.11
140 0.09
141 0.11
142 0.13
143 0.14
144 0.15
145 0.14
146 0.13
147 0.14
148 0.15
149 0.14
150 0.14
151 0.16
152 0.18
153 0.18
154 0.2
155 0.21
156 0.21
157 0.22
158 0.21
159 0.19
160 0.17
161 0.18
162 0.18
163 0.16
164 0.16
165 0.17
166 0.17
167 0.17
168 0.18
169 0.18
170 0.18
171 0.2
172 0.23
173 0.26
174 0.27
175 0.26
176 0.25
177 0.24
178 0.22
179 0.2
180 0.14
181 0.09
182 0.06
183 0.07
184 0.06
185 0.05
186 0.06
187 0.06
188 0.05
189 0.06
190 0.06
191 0.06
192 0.09
193 0.1
194 0.12
195 0.14
196 0.15
197 0.15
198 0.15
199 0.16
200 0.18
201 0.18
202 0.17
203 0.18
204 0.19
205 0.22
206 0.23
207 0.24
208 0.26
209 0.33
210 0.32
211 0.3
212 0.31
213 0.29
214 0.31
215 0.31
216 0.29
217 0.21
218 0.21
219 0.22
220 0.2
221 0.19
222 0.16
223 0.14
224 0.12
225 0.13
226 0.13
227 0.13
228 0.13
229 0.13
230 0.14
231 0.14
232 0.15
233 0.15
234 0.14
235 0.13
236 0.13
237 0.13
238 0.12
239 0.1
240 0.08
241 0.07
242 0.08
243 0.08
244 0.09
245 0.12
246 0.14
247 0.16
248 0.19
249 0.19
250 0.18
251 0.18
252 0.18
253 0.16