Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1R9L6

Protein Details
Accession N1R9L6    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
99-123EVYESPKVTPRKRRAPKTPESDSKAHydrophilic
NLS Segment(s)
PositionSequence
78-92KKATSARKRGPKAKK
108-115PRKRRAPK
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, cyto 1.5
Family & Domain DBs
Amino Acid Sequences MSDAAVKPNAWTDEAKNELLLRIIAQLKPEGKSINWSEINMEGRTVKSLQNQWTFFNKKLEAFKTQSNDGSTPSTPAKKATSARKRGPKAKKVAPDDDEVYESPKVTPRKRRAPKTPESDSKAVKKELSEAVVKDEEMEDDRDVDGEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.28
4 0.27
5 0.25
6 0.23
7 0.21
8 0.13
9 0.14
10 0.16
11 0.16
12 0.17
13 0.21
14 0.22
15 0.23
16 0.25
17 0.22
18 0.19
19 0.26
20 0.27
21 0.3
22 0.29
23 0.28
24 0.27
25 0.3
26 0.33
27 0.26
28 0.24
29 0.17
30 0.16
31 0.18
32 0.18
33 0.16
34 0.18
35 0.23
36 0.3
37 0.35
38 0.36
39 0.37
40 0.44
41 0.46
42 0.43
43 0.42
44 0.37
45 0.33
46 0.37
47 0.37
48 0.34
49 0.34
50 0.35
51 0.33
52 0.34
53 0.32
54 0.29
55 0.27
56 0.23
57 0.23
58 0.18
59 0.18
60 0.18
61 0.18
62 0.16
63 0.18
64 0.17
65 0.19
66 0.24
67 0.33
68 0.4
69 0.47
70 0.55
71 0.62
72 0.67
73 0.72
74 0.77
75 0.75
76 0.73
77 0.72
78 0.73
79 0.7
80 0.7
81 0.63
82 0.58
83 0.51
84 0.44
85 0.39
86 0.3
87 0.27
88 0.2
89 0.18
90 0.15
91 0.19
92 0.24
93 0.3
94 0.4
95 0.46
96 0.57
97 0.67
98 0.76
99 0.81
100 0.83
101 0.86
102 0.84
103 0.84
104 0.82
105 0.8
106 0.76
107 0.71
108 0.69
109 0.65
110 0.59
111 0.51
112 0.43
113 0.4
114 0.39
115 0.36
116 0.32
117 0.28
118 0.3
119 0.3
120 0.29
121 0.25
122 0.21
123 0.19
124 0.18
125 0.2
126 0.15
127 0.15
128 0.15